APIbase — Universal API Hub for AI Agents
Compliance Checks
2 issues
- OpenAPI doc exceeds 64KB limit (1291998 bytes)
- Endpoint POST /api/v1/tools/weather.get_current/call returned 401 (expected 402)
Paid Operations (484)
POST /api/v1/tools/weather.get_current/call dynamic
Get current weather conditions for a location
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| location | string | Yes | City name, coordinates (lat,lon), or zip code |
| units | string | No |
Temperature units system
enum: metric, imperial |
POST /api/v1/tools/weather.get_forecast/call dynamic
Get weather forecast for a location
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| location | string | Yes | City name, coordinates (lat,lon), or zip code |
| type | string | No |
Forecast granularity: hourly, daily, or both
enum: hourly, daily, both |
| units | string | No |
Temperature units system
enum: metric, imperial |
POST /api/v1/tools/weather.get_alerts/call dynamic
Get active weather alerts for a location
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| location | string | Yes | City name, coordinates (lat,lon), or zip code |
POST /api/v1/tools/weather.get_history/call dynamic
Get historical weather data for a location and date
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | Yes | Historical date in YYYY-MM-DD format |
| location | string | Yes | City name, coordinates (lat,lon), or zip code |
| units | string | No |
Temperature units system
enum: metric, imperial |
POST /api/v1/tools/weather.air_quality/call dynamic
Get air quality index for a location
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| include_forecast | boolean | No | Include air quality forecast for next 24h |
| location | string | Yes | City name, coordinates (lat,lon), or zip code |
POST /api/v1/tools/weather.geocode/call dynamic
Geocode a location query to coordinates
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max number of results (1-5) |
| query | string | Yes | Location name or coordinates to geocode |
| type | string | No |
Geocoding direction: forward (name to coords) or reverse (coords to name)
enum: forward, reverse |
POST /api/v1/tools/weather.compare/call dynamic
Compare weather across multiple locations
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| locations | array | Yes | List of 2-5 locations to compare |
| units | string | No |
Temperature units system
enum: metric, imperial |
POST /api/v1/tools/crypto.get_price/call dynamic
Get current prices for cryptocurrencies
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coins | array | Yes | List of coin IDs to get prices for |
| include_24h_change | boolean | No | Include 24-hour price change percentage |
| include_market_cap | boolean | No | Include market capitalization |
| include_volume | boolean | No | Include 24-hour trading volume |
| vs_currencies | array | No | Target currencies for price conversion |
POST /api/v1/tools/coingecko.get_market/call dynamic
Get cryptocurrency market data by category
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No |
Filter by market category
enum: defi, layer-1, layer-2, gaming, ai-big-data, meme-token, stablecoins, nft, exchange-based-tokens, real-world-assets |
| include_sparkline | boolean | No | Include 7-day sparkline price data |
| limit | integer | No | Max number of results (1-250) |
| sort_by | string | No |
Sort order for results
enum: market_cap_desc, market_cap_asc, volume_desc, price_desc, price_change_24h_desc |
POST /api/v1/tools/crypto.coin_detail/call dynamic
Get detailed information about a cryptocurrency
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coin_id | string | Yes | CoinGecko coin ID (e.g. bitcoin, ethereum) |
| include_community | boolean | No | Include community/social stats |
| include_description | boolean | No | Include coin description text |
| include_developer | boolean | No | Include developer/GitHub stats |
POST /api/v1/tools/crypto.price_history/call dynamic
Get price history for a cryptocurrency
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coin_id | string | Yes | CoinGecko coin ID (e.g. bitcoin, ethereum) |
| days | integer | No | Number of days of history (1-365) |
| format | string | No |
Response format: timeseries (price points) or ohlcv (candlestick data)
enum: timeseries, ohlcv |
| interval | string | No |
Data point interval for price history (5m, hourly, or daily)
enum: 5m, hourly, daily |
POST /api/v1/tools/crypto.trending/call dynamic
Get trending cryptocurrencies
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| include_categories | boolean | No | Include trending categories |
| include_nfts | boolean | No | Include trending NFT collections |
POST /api/v1/tools/crypto.global/call dynamic
Get global cryptocurrency market statistics
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| include_defi | boolean | No | Include DeFi-specific global stats |
POST /api/v1/tools/crypto.dex_pools/call dynamic
Get DEX liquidity pool data
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max number of results (1-50) |
| network | string | No |
Blockchain network to query (e.g. ethereum, bsc, polygon, solana)
enum: ethereum, bsc, polygon, arbitrum, solana, base, avalanche, optimism |
| query | string | No | Search query for pool name or token |
| sort_by | string | No |
Sort order for pool results
enum: volume_24h, liquidity, price_change_24h, transactions_24h |
POST /api/v1/tools/crypto.token_by_address/call dynamic
Get token info by contract address
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| contract_address | string | Yes | Token contract address (e.g. 0x...) |
| network | string | No |
Blockchain network to query (e.g. ethereum, bsc, polygon, solana)
enum: ethereum, bsc, polygon, arbitrum, solana, base, avalanche, optimism |
POST /api/v1/tools/crypto.search/call dynamic
Search for cryptocurrencies by name or symbol
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| query | string | Yes | Search query for coin name, symbol, or ID |
POST /api/v1/tools/polymarket.search/call dynamic
Search prediction markets on Polymarket
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No |
Filter by market category
enum: politics, crypto, sports, finance, science, culture, geopolitics, iran, economics |
| limit | integer | No | Max number of results (1-100) |
| query | string | Yes | Search query for prediction markets |
| sort_by | string | No |
Sort order for results
enum: volume, newest, ending_soon, probability_high, probability_low |
| status | string | No |
Filter by market status
enum: active, resolved, all |
POST /api/v1/tools/polymarket.market_detail/call dynamic
Get detailed info about a prediction market
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| include_history | boolean | No | Include recent price history |
| include_orderbook | boolean | No | Include current order book snapshot |
| market_id | string | Yes | Polymarket condition ID or slug |
POST /api/v1/tools/polymarket.prices/call dynamic
Get midpoint price for a prediction market token
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| token_id | string | Yes | Polymarket CLOB token ID |
POST /api/v1/tools/polymarket.price_history/call dynamic
Get price history for a prediction market
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| days | integer | No | Number of days of history (1-365) |
| interval | string | No |
Price data interval for history (1h, 4h, 1d, or 1w)
enum: 1h, 4h, 1d, 1w |
| market_id | string | Yes | Polymarket condition ID |
POST /api/v1/tools/polymarket.get_orderbook/call dynamic
Get order book for a prediction market
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| depth | integer | No | Number of price levels per side (1-50) |
| market_id | string | Yes | Polymarket condition ID |
POST /api/v1/tools/polymarket.trending/call dynamic
Get trending prediction markets
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No |
Filter by market category
enum: politics, crypto, sports, finance, science, culture, geopolitics |
| limit | integer | No | Max number of results (1-50) |
| sort_by | string | No |
Sort order for trending markets
enum: volume_24h, newest, biggest_move, ending_soon |
POST /api/v1/tools/polymarket.place_order/call dynamic
Place a limit order on Polymarket
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| neg_risk | boolean | No | Whether this is a negative risk market |
| order_type | string | No |
Order type: Good-Til-Cancelled, Good-Til-Date, Fill-Or-Kill
enum: GTC, GTD, FOK |
| price | number | Yes | Limit price between 0.01 and 0.99 |
| side | string | Yes |
Order side: buy or sell
enum: buy, sell |
| size | number | Yes | Order size in USDC units |
| tick_size | string | No | Minimum price increment (e.g. 0.01, 0.001) |
| token_id | string | Yes | Polymarket CLOB token ID to trade |
POST /api/v1/tools/polymarket.cancel_order/call dynamic
Cancel an open order on Polymarket
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| order_id | string | Yes | Polymarket order ID to cancel (from open_orders response) |
POST /api/v1/tools/polymarket.open_orders/call dynamic
Get open orders on Polymarket
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| market_id | string | No | Filter orders by market condition ID |
POST /api/v1/tools/polymarket.trade_history/call dynamic
Get trade history on Polymarket
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max number of results (1-100) |
| market_id | string | No | Filter trades by market condition ID |
POST /api/v1/tools/polymarket.balance/call dynamic
Get balance/allowance on Polymarket
- Amount
- 0.000500
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000500 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| asset_type | string | No |
Asset type: COLLATERAL (USDC) or CONDITIONAL (outcome tokens)
enum: COLLATERAL, CONDITIONAL |
POST /api/v1/tools/sabre.search_flights/call dynamic
Search for real-time flight offers with prices between airports (Sabre GDS)
- Amount
- 0.010000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.010000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| departure_date | string | Yes | Departure date in YYYY-MM-DD format |
| destination | string | Yes | Destination airport IATA code (e.g. CDG, LHR) |
| limit | integer | No | Max number of flight offers (1-50) |
| origin | string | Yes | Origin airport IATA code (e.g. JFK, LAX) |
| point_of_sale | string | No |
2-letter country code for pricing (e.g. US, GB)
default: US
|
| return_date | string | No | Return date in YYYY-MM-DD format for round trips |
POST /api/v1/tools/sabre.destination_finder/call dynamic
Find cheapest flight destinations from an origin airport
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| departure_date | string | Yes | Departure date in YYYY-MM-DD format |
| max_fare | number | No | Maximum fare in USD to filter results |
| origin | string | Yes | Origin airport IATA code (e.g. JFK, LAX) |
| point_of_sale | string | No |
2-letter country code for pricing (e.g. US, GB)
default: US
|
| return_date | string | Yes | Return date in YYYY-MM-DD format |
POST /api/v1/tools/sabre.airline_lookup/call dynamic
Look up airline details by IATA or ICAO code
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| airline_code | string | Yes | Airline IATA (2-char) or ICAO (3-char) code |
POST /api/v1/tools/sabre.travel_themes/call dynamic
Get travel theme categories (beach, skiing, romantic, etc.)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| locale | string | No | Response locale (e.g. en-US, de-DE) |
POST /api/v1/tools/amadeus.flight_search/call dynamic
⚡ ACTION: Search for real-time flight offers between airports with prices, airlines, stops, and duration (Amadeus)
- Amount
- 0.035000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.035000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| adults | integer | No |
Number of adult passengers (1-9)
default: 1
|
| currency | string | No |
Price currency ISO code (e.g. USD, EUR)
default: USD
|
| departure_date | string | Yes | Departure date in YYYY-MM-DD format |
| destination | string | Yes | Destination airport IATA code (e.g. CDG, LHR) |
| max_results | integer | No |
Max number of flight offers (1-50)
default: 10
|
| nonstop | boolean | No | Only return non-stop flights |
| origin | string | Yes | Origin airport IATA code (e.g. JFK, LAX) |
| return_date | string | No | Return date in YYYY-MM-DD format for round trips |
| travel_class | string | No |
Cabin class: ECONOMY, PREMIUM_ECONOMY, BUSINESS, or FIRST (default ECONOMY)
enum: ECONOMY, PREMIUM_ECONOMY, BUSINESS, FIRST default: ECONOMY
|
POST /api/v1/tools/amadeus.flight_price/call dynamic
Confirm and get final pricing for a flight offer from Amadeus flight search
- Amount
- 0.020000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.020000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| flight_offer | object | Yes | Flight offer object from flight_search results |
POST /api/v1/tools/amadeus.flight_status/call dynamic
Get real-time status of a specific flight — delays, cancellations, gate info (Amadeus)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| carrier_code | string | Yes | Airline IATA or ICAO code (e.g. AA, UAL) |
| date | string | Yes | Flight date in YYYY-MM-DD format |
| flight_number | string | Yes | Flight number (e.g. 100, 1234) |
POST /api/v1/tools/amadeus.airport_search/call dynamic
Search airports and cities by keyword or IATA code with autocomplete (Amadeus)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| keyword | string | Yes | Airport or city name to search (e.g. London, JFK) |
| subType | string | No |
Filter by location type
enum: AIRPORT, CITY |
POST /api/v1/tools/amadeus.airport_nearest/call dynamic
Find nearest airports by geographic coordinates (Amadeus)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| latitude | number | Yes | Latitude in decimal degrees (-90 to 90) |
| longitude | number | Yes | Longitude in decimal degrees (-180 to 180) |
| radius | integer | No |
Search radius in km (1-500)
default: 500
|
POST /api/v1/tools/amadeus.airport_routes/call dynamic
Get all direct flight destinations from an airport (Amadeus)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| airport_code | string | Yes | Airport IATA code (e.g. JFK, LAX) |
POST /api/v1/tools/amadeus.airline_lookup/call dynamic
Look up airline details by IATA or ICAO code (Amadeus)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| airline_code | string | Yes | Airline IATA (2-char) or ICAO (3-char) code |
POST /api/v1/tools/aviasales.search_flights/call dynamic
Search for flights between airports
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| currency | string | No | Currency code for prices (default usd) |
| departure_date | string | No | Departure date in YYYY-MM-DD format (filters results to this date and later) |
| destination | string | No | Arrival IATA code (omit to search all destinations) |
| direct_only | boolean | No | Only show non-stop flights (default false) |
| limit | integer | No | Max number of results to return (default 10) |
| origin | string | Yes | Departure city or airport IATA code (e.g. MOW, JFK, BKK) |
POST /api/v1/tools/aviasales.price_calendar/call dynamic
Get flight price calendar for a route
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| currency | string | No | Currency code for prices (default usd) |
| destination | string | Yes | Arrival IATA code (e.g. BKK, LON) |
| month | string | No | Month in YYYY-MM format to get calendar prices (e.g. 2026-06) |
| origin | string | Yes | Departure city or airport IATA code (e.g. MOW, JFK) |
POST /api/v1/tools/aviasales.cheap_flights/call dynamic
Find cheapest flights from an origin
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| currency | string | No | Currency code for prices (default usd) |
| departure_month | string | No | Filter by departure month in YYYY-MM format |
| destination | string | No | Arrival IATA code (omit to find cheapest flights to anywhere) |
| direct_only | boolean | No | Only return direct (non-stop) flights |
| origin | string | Yes | Departure city or airport IATA code (e.g. MOW, BER) |
POST /api/v1/tools/aviasales.popular_routes/call dynamic
Get popular flight routes from an origin
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| currency | string | No | Currency code for prices (default usd) |
| origin | string | Yes | Departure city IATA code (e.g. MOW, NYC, LON) |
POST /api/v1/tools/aviasales.nearby_destinations/call dynamic
Find nearby flight destinations
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| currency | string | No | Currency code for prices (default usd) |
| depart_date | string | No | Departure date in YYYY-MM-DD format |
| destination | string | Yes | Target destination IATA code — also searches nearby airports |
| flexibility | integer | No | Date flexibility in days (+/- from given dates) |
| origin | string | Yes | Departure city IATA code (e.g. MOW) |
| return_date | string | No | Return date in YYYY-MM-DD format |
POST /api/v1/tools/aviasales.airport_lookup/call dynamic
Look up airport by name or code
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| query | string | Yes | Airport name, city name, or IATA code to search for (e.g. Bangkok, JFK, Heathrow) |
POST /api/v1/tools/hyperliquid.market_data/call dynamic
Get market metadata and mid prices for all perpetual pairs on Hyperliquid
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coin | string | No | Specific coin symbol (e.g. BTC, ETH). Omit for all markets. |
POST /api/v1/tools/hyperliquid.order_book/call dynamic
Get L2 order book depth for a perpetual pair on Hyperliquid
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coin | string | Yes | Coin symbol (e.g. BTC, ETH) |
| mantissa | integer | No | Mantissa for price rounding |
| n_sig_figs | integer | No | Number of significant figures for price levels |
POST /api/v1/tools/hyperliquid.klines/call dynamic
Get candlestick (OHLCV) data for a perpetual pair on Hyperliquid
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coin | string | Yes | Coin symbol (e.g. BTC, ETH) |
| end_time | integer | No | End time in milliseconds since epoch |
| interval | string | No |
Candlestick interval (1m, 5m, 15m, 1h, 4h, 1d, 1w)
enum: 1m, 3m, 5m, 15m, 30m, 1h, 2h, 4h, 6h, 8h, 12h, 1d, 3d, 1w, 1M |
| start_time | integer | No | Start time in milliseconds since epoch |
POST /api/v1/tools/hyperliquid.positions/call dynamic
Get open positions for a user wallet on Hyperliquid
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| user | string | Yes | User wallet address (0x...) |
POST /api/v1/tools/hyperliquid.account/call dynamic
Get account summary and margin details for a user wallet on Hyperliquid
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| user | string | Yes | User wallet address (0x...) |
POST /api/v1/tools/hyperliquid.vault/call dynamic
Get vault details including performance and TVL on Hyperliquid
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| vault_address | string | Yes | Vault contract address (0x...) |
POST /api/v1/tools/foursquare.place_search/call dynamic
Search for places (restaurants, hotels, cafes, attractions) worldwide by name, category, or location (Foursquare)
- Amount
- 0.025000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.025000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| categories | string | No | Comma-separated Foursquare category IDs to filter results |
| limit | integer | No | Max results to return (1-50, default 10) |
| ll | string | No | Latitude,longitude (e.g. "13.7563,100.5018"). Use either near or ll, not both |
| near | string | No | Place name for geographic context (e.g. "Bangkok,Thailand", "New York,NY") |
| open_now | boolean | No | Filter to only places open now |
| query | string | No | Search term (e.g. "restaurant", "coffee", "hotel") |
| radius | integer | No | Search radius in meters (max 100000) |
| sort | string | No |
Sort order for results
enum: relevance, rating, distance, popularity |
POST /api/v1/tools/foursquare.place_details/call dynamic
Get detailed information about a place — hours, rating, price, contact, categories (Foursquare)
- Amount
- 0.025000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.025000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fsq_id | string | Yes | Foursquare place ID (e.g. "4b5988fef964a520e62a28e3") |
POST /api/v1/tools/foursquare.place_tips/call dynamic
Get user tips and reviews for a place (Foursquare)
- Amount
- 0.030000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.030000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fsq_id | string | Yes | Foursquare place ID to get tips for |
| limit | integer | No | Max tips to return (1-50, default 10) |
| sort | string | No |
Sort order for tips: popular, newest, or oldest
enum: popular, newest, oldest |
POST /api/v1/tools/foursquare.place_photos/call dynamic
Get photos for a place with size and classification options (Foursquare)
- Amount
- 0.030000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.030000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| classifications | string | No | Comma-separated photo classifications (e.g. "food,indoor,outdoor") |
| fsq_id | string | Yes | Foursquare place ID to get photos for |
| limit | integer | No | Max photos to return (1-50, default 10) |
| sort | string | No |
Sort order for photos: popular or newest
enum: popular, newest |
POST /api/v1/tools/foursquare.autocomplete/call dynamic
Get autocomplete suggestions for places, addresses, and searches (Foursquare)
- Amount
- 0.020000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.020000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max suggestions to return (1-10, default 5) |
| ll | string | No | Latitude,longitude to bias results (e.g. "13.7563,100.5018") |
| query | string | Yes | Search query for autocomplete suggestions |
| radius | integer | No | Bias radius in meters for location results |
| types | string | No | Comma-separated result types (e.g. "place,address,search") |
POST /api/v1/tools/ticketmaster.events_search/call dynamic
Search for events (concerts, sports, theatre, festivals) by keyword, city, date, or category across 26+ countries (Ticketmaster)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| city | string | No | City name to filter events (e.g. "New York", "London") |
| classificationName | string | No | Event category filter (e.g. "Music", "Sports", "Arts & Theatre") |
| countryCode | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "GB", "DE") |
| endDateTime | string | No | End date/time in ISO 8601 format with Z suffix (e.g. "2026-12-31T23:59:59Z") |
| keyword | string | No | Search keyword (e.g. "concert", "NBA", "Taylor Swift") |
| locale | string | No | Locale for response (e.g. "en-us", "fr-fr") |
| page | integer | No | Page number for pagination (0-based, default 0) |
| size | integer | No | Number of results per page (1-200, default 20) |
| sort | string | No | Sort order (e.g. "date,asc", "relevance,desc", "name,asc") |
| startDateTime | string | No | Start date/time in ISO 8601 format with Z suffix (e.g. "2026-04-01T00:00:00Z") |
| stateCode | string | No | State code for US/CA events (e.g. "NY", "CA", "ON") |
POST /api/v1/tools/ticketmaster.event_details/call dynamic
Get full details for an event — dates, venues, prices, images, classifications, seat map (Ticketmaster)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | string | Yes | Ticketmaster event ID (e.g. "vvG1iZ4JkS1GKT") |
| locale | string | No | Locale for response (e.g. "en-us") |
POST /api/v1/tools/ticketmaster.events_nearby/call dynamic
Find events near geographic coordinates with radius filter (Ticketmaster)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| classificationName | string | No | Event category filter (e.g. "Music", "Sports") |
| endDateTime | string | No | End date/time in ISO 8601 format with Z suffix |
| keyword | string | No | Optional keyword filter (e.g. "jazz", "basketball") |
| latlong | string | Yes | Latitude,longitude coordinates (e.g. "40.7128,-74.0060" for NYC) |
| locale | string | No | Locale for response (e.g. "en-us") |
| page | integer | No | Page number for pagination (0-based, default 0) |
| radius | integer | No | Search radius (default unit: miles, max 500) |
| size | integer | No | Number of results per page (1-200, default 20) |
| sort | string | No | Sort order (e.g. "date,asc", "distance,asc") |
| startDateTime | string | No | Start date/time in ISO 8601 format with Z suffix |
| unit | string | No |
Distance unit for radius (default: miles)
enum: miles, km |
POST /api/v1/tools/ticketmaster.artist_events/call dynamic
Find events by artist or performer name with optional country and date filters (Ticketmaster)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| attractionId | string | No | Ticketmaster attraction ID for exact artist match |
| countryCode | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "GB") |
| endDateTime | string | No | End date/time in ISO 8601 format with Z suffix |
| keyword | string | No | Artist/performer name to search (e.g. "Beyonce", "Coldplay") |
| locale | string | No | Locale for response (e.g. "en-us") |
| page | integer | No | Page number for pagination (0-based, default 0) |
| size | integer | No | Number of results per page (1-200, default 20) |
| sort | string | No | Sort order (e.g. "date,asc", "relevance,desc") |
| startDateTime | string | No | Start date/time in ISO 8601 format with Z suffix |
POST /api/v1/tools/ticketmaster.venue_events/call dynamic
Get upcoming events at a specific venue by venue ID (Ticketmaster)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| endDateTime | string | No | End date/time in ISO 8601 format with Z suffix |
| keyword | string | No | Optional keyword filter for events at this venue |
| locale | string | No | Locale for response (e.g. "en-us") |
| page | integer | No | Page number for pagination (0-based, default 0) |
| size | integer | No | Number of results per page (1-200, default 20) |
| sort | string | No | Sort order (e.g. "date,asc", "relevance,desc") |
| startDateTime | string | No | Start date/time in ISO 8601 format with Z suffix |
| venueId | string | Yes | Ticketmaster venue ID (e.g. "KovZpZA7AAEA" for Madison Square Garden) |
POST /api/v1/tools/ticketmaster.events_trending/call dynamic
Get trending and popular events sorted by relevance (Ticketmaster)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| classificationName | string | No | Event category filter (e.g. "Music", "Sports") |
| countryCode | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "GB") |
| locale | string | No | Locale for response (e.g. "en-us") |
| page | integer | No | Page number for pagination (0-based, default 0) |
| size | integer | No | Number of results per page (1-200, default 20) |
POST /api/v1/tools/ticketmaster.events_categories/call dynamic
Get all event classification categories — segments, genres, sub-genres (Ticketmaster)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| locale | string | No | Locale for response (e.g. "en-us") |
| page | integer | No | Page number for pagination (0-based, default 0) |
| size | integer | No | Number of results per page (1-200, default 20) |
POST /api/v1/tools/tmdb.movie_search/call dynamic
Search for movies, TV shows, and people by name across 1M+ titles in 39 languages (TMDB)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| include_adult | boolean | No | Include adult content in results (default false) |
| language | string | No | ISO 639-1 language code (e.g. "en-US", "de-DE", "ja-JP"). Default: en-US |
| page | integer | No | Page number (1-500, default 1) |
| query | string | Yes | Search query (movie, TV show, or person name) |
POST /api/v1/tools/tmdb.movie_details/call dynamic
Get full movie details — cast, crew, trailers, ratings, streaming providers, runtime, budget, revenue (TMDB)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | TMDB movie ID (e.g. 550 for Fight Club, 27205 for Inception) |
| language | string | No | ISO 639-1 language code (e.g. "en-US"). Default: en-US |
POST /api/v1/tools/tmdb.movie_discover/call dynamic
Discover movies or TV shows by genre, year, rating, language, and sort order (TMDB)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| first_air_date_year | integer | No | Filter by first air date year (TV only) |
| include_adult | boolean | No | Include adult content (default false) |
| language | string | No | ISO 639-1 language code (e.g. "en-US"). Default: en-US |
| page | integer | No | Page number (1-500, default 1) |
| primary_release_year | integer | No | Filter by primary release year (movies only) |
| region | string | No | ISO 3166-1 region for release dates (e.g. "US", "GB") |
| sort_by | string | No | Sort field (e.g. "popularity.desc", "vote_average.desc", "revenue.desc", "primary_release_date.desc") |
| type | string | No |
Content type to discover: "movie" or "tv" (default "movie")
enum: movie, tv |
| vote_average_gte | number | No | Minimum vote average (0-10) |
| vote_average_lte | number | No | Maximum vote average (0-10) |
| with_genres | string | No | Comma-separated genre IDs to filter (e.g. "28,12" for Action+Adventure) |
| with_original_language | string | No | ISO 639-1 original language filter (e.g. "en", "ko", "ja") |
| year | integer | No | Filter by release year (movies only) |
POST /api/v1/tools/tmdb.movie_trending/call dynamic
Get trending movies, TV shows, or people — daily or weekly (TMDB)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| language | string | No | ISO 639-1 language code (e.g. "en-US"). Default: en-US |
| page | integer | No | Page number (1-500, default 1) |
| type | string | No |
Content type: "movie", "tv", "person", or "all" (default "movie")
enum: movie, tv, person, all |
| window | string | No |
Time window: "day" or "week" (default "week")
enum: day, week |
POST /api/v1/tools/tmdb.movie_similar/call dynamic
Get movie recommendations based on a movie ID — similar genres, themes, cast (TMDB)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | TMDB movie ID to get recommendations for |
| language | string | No | ISO 639-1 language code (e.g. "en-US"). Default: en-US |
| page | integer | No | Page number (1-500, default 1) |
POST /api/v1/tools/tmdb.movie_person/call dynamic
Search for actors, directors, or crew by name, or get full filmography by person ID (TMDB)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | No | TMDB person ID for detailed filmography (e.g. 31 for Tom Hanks). Use either id or query |
| include_adult | boolean | No | Include adult content (default false) |
| language | string | No | ISO 639-1 language code (e.g. "en-US"). Default: en-US |
| page | integer | No | Page number for search results (1-500, default 1) |
| query | string | No | Person name to search for (e.g. "Tom Hanks", "Miyazaki"). Use either query or id |
POST /api/v1/tools/tmdb.movie_where_to_watch/call dynamic
Find streaming, rental, and purchase options for a movie or TV show by country (TMDB)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | TMDB movie or TV show ID |
| type | string | No |
Content type: "movie" or "tv" (default "movie")
enum: movie, tv |
POST /api/v1/tools/health.food_search/call dynamic
Search 350K+ foods in the USDA FoodData Central database — nutrition facts, ingredients, branded products, and reference foods
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| brand_owner | string | No | Filter by brand owner name (e.g. "General Mills", "Tyson") |
| data_type | string | No |
USDA data type filter: "Foundation" (reference foods), "Branded" (brand-name products), "SR Legacy" (legacy reference), "all" (default)
enum: Foundation, Branded, SR Legacy, all |
| page_number | integer | No | Page number (default 1) |
| page_size | integer | No | Results per page (1-200, default 50) |
| query | string | Yes | Food search query (e.g. "chicken breast", "brown rice", "vitamin D milk") |
POST /api/v1/tools/health.food_details/call dynamic
Get detailed nutrition data for a food item — up to 150 nutrients, portions, serving sizes, ingredients (USDA)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fdc_id | integer | Yes | USDA FoodData Central food ID (e.g. 171705 for chicken breast) |
POST /api/v1/tools/health.drug_events/call dynamic
Search FDA FAERS database for drug adverse event reports — side effects, reactions, patient demographics (OpenFDA)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-100, default 10) |
| search | string | Yes | OpenFDA search query for adverse events (e.g. "patient.drug.medicinalproduct:aspirin", "patient.reaction.reactionmeddrapt:headache") |
| skip | integer | No | Number of results to skip for pagination |
POST /api/v1/tools/health.food_recalls/call dynamic
Search FDA food enforcement and recall reports — contamination, mislabeling, safety alerts (OpenFDA)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-100, default 10) |
| search | string | No | OpenFDA search query for food recalls (e.g. "reason_for_recall:salmonella", "recalling_firm:"Tyson"") |
| skip | integer | No | Number of results to skip for pagination |
| status | string | No |
Filter by recall status
enum: Ongoing, Completed, Terminated |
POST /api/v1/tools/health.drug_labels/call dynamic
Search drug labeling data — indications, dosage, warnings, interactions, contraindications (OpenFDA)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-100, default 10) |
| search | string | Yes | OpenFDA search query for drug labels (e.g. "openfda.brand_name:ibuprofen", "openfda.generic_name:metformin", "drug_interactions:warfarin") |
| skip | integer | No | Number of results to skip for pagination |
POST /api/v1/tools/health.supplement_search/call dynamic
Search 200K+ dietary supplement labels in the NIH DSLD database — vitamins, minerals, herbal products
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-100, default 25) |
| offset | integer | No | Result offset for pagination |
| query | string | Yes | Supplement search query (e.g. "vitamin D", "fish oil", "probiotics") |
POST /api/v1/tools/health.supplement_details/call dynamic
Get full supplement label data — ingredients, amounts per serving, daily values, target groups (NIH DSLD)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| dsld_id | integer | Yes | NIH DSLD supplement label ID |
POST /api/v1/tools/finance.exchange_rates/call dynamic
Get currency exchange rates for 200+ fiat and crypto currencies with optional historical dates (fawazahmed0 CDN)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| base | string | Yes | Base currency code (e.g. "usd", "eur", "btc"). Lowercase. 200+ currencies supported. |
| currencies | array | No | Filter to specific target currencies (e.g. ["eur","gbp"]). Omit for all. |
| date | string | No | Historical date in YYYY-MM-DD format. Omit for latest rates. |
POST /api/v1/tools/finance.ecb_rates/call dynamic
Get official European Central Bank reference exchange rates for ~33 fiat currencies (Frankfurter/ECB)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| base | string | Yes | Base currency code, uppercase (e.g. "USD", "EUR"). ~33 ECB currencies. |
| currencies | array | No | Filter to specific target currencies (e.g. ["EUR","GBP"]). Omit for all ECB currencies. |
| date | string | No | Historical date in YYYY-MM-DD format. Omit for latest ECB rates. |
POST /api/v1/tools/finance.economic_indicator/call dynamic
Get US economic data from 816K+ FRED series — GDP, CPI, unemployment, interest rates, money supply (Federal Reserve)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Maximum number of observations to return (default 100000). |
| observation_end | string | No | End date for observations in YYYY-MM-DD format. |
| observation_start | string | No | Start date for observations in YYYY-MM-DD format. |
| series_id | string | Yes | FRED series ID (e.g. "GDP", "CPIAUCSL", "UNRATE", "DFF", "T10Y2Y"). Browse at fred.stlouisfed.org. |
| sort_order | string | No |
Sort order by observation date. Default "asc".
enum: asc, desc |
POST /api/v1/tools/finance.country_data/call dynamic
Get global development indicators from World Bank — GDP, population, inflation, trade, poverty for 200+ countries
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | Yes | ISO 3166 country code (e.g. "US", "DE", "CHN") or "all" for all countries. |
| date_range | string | No | Year or year range (e.g. "2023" or "2010:2023"). Omit for all available years. |
| indicator_id | string | Yes | World Bank indicator ID (e.g. "NY.GDP.MKTP.CD" for GDP, "SP.POP.TOTL" for population, "FP.CPI.TOTL.ZG" for inflation). |
| per_page | integer | No | Results per page (default 50, max 1000). |
POST /api/v1/tools/finance.treasury_data/call dynamic
Get US Treasury fiscal data — interest rates on federal debt, national debt, debt outstanding, gold reserves, exchange rates
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| endpoint | string | Yes |
Treasury dataset endpoint: avg_interest_rates (interest rates on federal debt), debt_to_penny (daily national debt), debt_outstanding (debt by security type), top_federal (top federal spending), gold_reserve (US gold reserves), exchange_rates_report (Treasury exchange rates).
enum: avg_interest_rates, debt_to_penny, debt_outstanding, top_federal, gold_reserve, exchange_rates_report |
| filter | string | No | Filter expression (e.g. "record_date:gte:2024-01-01,security_desc:eq:Treasury Bills"). See Treasury API docs. |
| page_size | integer | No | Number of records per page (default 100, max 10000). |
| sort | string | No | Sort field with direction prefix (e.g. "-record_date" for newest first). Default: "-record_date". |
POST /api/v1/tools/finance.validate_iban/call dynamic
Validate an IBAN number and get associated bank data — BIC/SWIFT code, bank name, city (OpenIBAN)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| iban | string | Yes | IBAN to validate (e.g. "DE89370400440532013000"). Spaces are stripped automatically. |
POST /api/v1/tools/music.artist_search/call dynamic
Search for music artists by name across 2M+ artists — biography, country, tags, aliases (MusicBrainz)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max results to return (1-100, default 25) |
| offset | integer | No | Pagination offset for results |
| query | string | Yes | Search query for artist name (e.g. "Radiohead", "Miles Davis") |
POST /api/v1/tools/music.artist_details/call dynamic
Get detailed artist info by MusicBrainz ID — tags, ratings, external links, life span, area (MusicBrainz)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| mbid | string | Yes | MusicBrainz artist ID (UUID format, e.g. "a74b1b7f-71a5-4011-9441-d0b5e4122711") |
POST /api/v1/tools/music.release_search/call dynamic
Search for albums, singles, and EPs across 50M+ recordings — title, artist, date (MusicBrainz)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max results to return (1-100, default 25) |
| offset | integer | No | Pagination offset for results |
| query | string | Yes | Search query for release/album title (e.g. "OK Computer", "Kind of Blue"). Supports Lucene syntax: artist:"Radiohead" AND release:"OK Computer" |
POST /api/v1/tools/music.release_details/call dynamic
Get full release details by MusicBrainz ID — artist credits, labels, media formats (MusicBrainz)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| mbid | string | Yes | MusicBrainz release ID (UUID format). Returns artist credits and label info |
POST /api/v1/tools/music.recording_search/call dynamic
Search for songs and recordings by title or artist — duration, release history, artist credits (MusicBrainz)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max results to return (1-100, default 25) |
| offset | integer | No | Pagination offset for results |
| query | string | Yes | Search query for song/recording title (e.g. "Creep", "So What"). Supports Lucene syntax: artist:"Radiohead" AND recording:"Creep" |
POST /api/v1/tools/music.fresh_releases/call dynamic
Discover recently released albums and singles from the past N days — trending new music (ListenBrainz)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| days | integer | No | Number of days to look back for fresh releases (1-90, default 7) |
| limit | integer | No | Max releases to return (1-200, default 50) |
POST /api/v1/tools/music.radio_search/call dynamic
Search 40K+ internet radio stations by name, genre, country, or language — streaming URLs, bitrate, codec (RadioBrowser)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | Country name filter (e.g. "Germany", "United States") |
| countrycode | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "DE", "GB") |
| hidebroken | boolean | No | Hide broken/offline stations (recommended: true) |
| language | string | No | Language filter (e.g. "english", "german", "spanish") |
| limit | integer | No | Max stations to return (1-100, default 25) |
| name | string | No | Station name to search for (e.g. "BBC Radio", "Jazz FM") |
| order | string | No |
Sort order for results
enum: name, url, homepage, favicon, tags, country, state, language, votes, codec, bitrate, lastcheckok, lastchecktime, clicktimestamp, clickcount, clicktrend, changetimestamp, random |
| tag | string | No | Tag/genre filter (e.g. "rock", "jazz", "classical", "news") |
POST /api/v1/tools/aster.exchange_info/call dynamic
Get exchange information and available trading pairs on AsterDEX
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| symbol | string | No | Trading pair symbol to filter (e.g. BTCUSDT). Omit for all pairs. |
POST /api/v1/tools/aster.market_data/call dynamic
Get 24-hour ticker statistics for trading pairs on AsterDEX
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| symbol | string | No | Trading pair symbol (e.g. BTCUSDT). Omit for all pairs. |
POST /api/v1/tools/aster.order_book/call dynamic
Get order book depth for a trading pair on AsterDEX
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Depth limit (default 20) |
| symbol | string | Yes | Trading pair symbol (e.g. BTCUSDT) |
POST /api/v1/tools/aster.klines/call dynamic
Get candlestick (OHLCV) data for a trading pair on AsterDEX
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| end_time | integer | No | End time in milliseconds since epoch |
| interval | string | No |
Candlestick interval (default 1h)
enum: 1m, 3m, 5m, 15m, 30m, 1h, 2h, 4h, 6h, 8h, 12h, 1d, 3d, 1w, 1M |
| limit | integer | No | Number of candles (default 100) |
| start_time | integer | No | Start time in milliseconds since epoch |
| symbol | string | Yes | Trading pair symbol (e.g. BTCUSDT) |
POST /api/v1/tools/jobs.salary_data/call dynamic
Get US salary and employment timeseries data from BLS — wage estimates, employment counts, occupational statistics by SOC code and geography
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| end_year | string | No | End year (e.g. "2024"). Omit for latest available. |
| series_ids | array | Yes | BLS timeseries IDs (e.g. ["OEUM0000000000000151252004"] for Software Developers mean salary). Encodes occupation code + geography + data type. |
| start_year | string | No | Start year (e.g. "2020"). Omit for latest available. |
POST /api/v1/tools/jobs.occupation_search/call dynamic
Search O*NET occupation taxonomy by keyword — 1,000+ occupations with SOC codes, titles, and relevance scores
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| end | integer | No | Ending index for pagination. Omit for default page size. |
| keyword | string | Yes | Search keyword for occupations (e.g. "software developer", "nurse", "data analyst"). |
| start | integer | No | Starting index for pagination (1-based). Omit for first page. |
POST /api/v1/tools/jobs.occupation_details/call dynamic
Get detailed occupation info from O*NET by SOC code — overview, skills, knowledge, abilities, technology skills, tasks
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| code | string | Yes | O*NET SOC occupation code (e.g. "15-1252.00" for Software Developers). Get codes from occupation_search. |
| section | string | No |
Specific section to retrieve. Omit for general overview (title, description, sample titles).
enum: skills, knowledge, abilities, technology_skills, tasks |
POST /api/v1/tools/jobs.esco_search/call dynamic
Search ESCO (European Skills/Competences/Occupations) taxonomy — occupations and skills in 27 EU languages
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| language | string | No | ISO 639-1 language code (e.g. "en", "de", "fr"). Default: "en". ESCO supports 27 EU languages. |
| limit | integer | No | Results per page (default 25, max 100). |
| offset | integer | No | Offset for pagination. Omit for first page. |
| text | string | Yes | Search text for EU occupations or skills (e.g. "software developer", "project management"). |
| type | string | No |
Resource type to search. Default: "occupation".
enum: occupation, skill |
POST /api/v1/tools/jobs.esco_details/call dynamic
Get ESCO resource details by URI — occupation descriptions, essential/optional skills, ISCO codes, skill relationships
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| language | string | No | ISO 639-1 language code. Default: "en". |
| type | string | No |
Resource type: "occupation" or "skill". Default: "occupation".
enum: occupation, skill |
| uri | string | Yes | ESCO resource URI (e.g. "http://data.europa.eu/esco/occupation/..."). Get URIs from esco_search. |
POST /api/v1/tools/jobs.job_search/call dynamic
Search global job listings via CareerJet — title, company, salary, location, contract type across 90+ countries
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| contract_type | string | No |
Filter by contract type.
enum: permanent, contract, temporary, internship, volunteering |
| keywords | string | Yes | Job search keywords (e.g. "software engineer", "marketing manager remote"). |
| locale_code | string | No | Locale code for results (e.g. "en_US", "en_GB", "de_DE"). Default: "en_US". |
| location | string | No | Location filter (e.g. "New York", "London", "Berlin"). Omit for worldwide. |
| page | integer | No | Page number (1-10). Default: 1. |
| page_size | integer | No | Results per page (1-100). Default: 20. |
| sort | string | No |
Sort order for results. Default: "relevance".
enum: relevance, date, salary |
| work_hours | string | No |
Filter by work hours: full_time or part_time
enum: full_time, part_time |
POST /api/v1/tools/education.paper_search/call dynamic
Search 250M+ academic papers across all disciplines — citations, authors, institutions, open access status (OpenAlex)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| author | string | No | Author name or ORCID to filter by (e.g. "Yoshua Bengio", "0000-0001-2345-6789"). |
| concept | string | No | OpenAlex concept ID filter (e.g. "C41008148" for Computer Science). Get IDs from OpenAlex concepts API. |
| institution | string | No | Institution name or ROR ID to filter by (e.g. "MIT", "Stanford University"). |
| limit | integer | No | Number of results to return (1-50). Default: 10. |
| open_access_only | boolean | No | If true, only return open access papers. |
| query | string | Yes | Search text for academic papers (e.g. "machine learning", "CRISPR gene editing"). |
| sort | string | No |
Sort order for results. Default: "relevance".
enum: relevance, cited_by_count, publication_date |
| year_from | integer | No | Filter papers published from this year (inclusive). |
| year_to | integer | No | Filter papers published up to this year (inclusive). |
POST /api/v1/tools/education.paper_details/call dynamic
Get full details for an academic paper by OpenAlex ID or DOI — authors, citations, abstract, references, open access links (OpenAlex)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | string | Yes | OpenAlex work ID (e.g. "W2741809807") or DOI (e.g. "10.1038/nature12373"). Get IDs from paper_search. |
POST /api/v1/tools/education.college_search/call dynamic
Search US colleges and universities — admissions, tuition, enrollment, earnings, completion rates (College Scorecard)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| degree_type | string | No |
Filter by predominant degree type awarded.
enum: associate, bachelor, graduate |
| limit | integer | No | Number of results to return (1-50). Default: 10. |
| name | string | No | School name to search for (e.g. "MIT", "Stanford", "Community College"). |
| program | string | No | Field of study filter (e.g. "Computer Science", "Nursing", "Business"). |
| state | string | No | US state abbreviation (e.g. "CA", "NY", "TX"). |
POST /api/v1/tools/education.college_details/call dynamic
Get detailed data for a US college by UNITID — admissions rate, costs, student outcomes, earnings after graduation (College Scorecard)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| school_id | integer | Yes | College Scorecard UNITID (e.g. 166027 for MIT). Get IDs from college_search. |
POST /api/v1/tools/education.pubmed_search/call dynamic
Search 36M+ biomedical and life science articles — clinical trials, reviews, meta-analyses with date and type filters (PubMed/NCBI)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date_from | string | No | Start date filter in YYYY/MM/DD format (e.g. "2023/01/01"). |
| date_to | string | No | End date filter in YYYY/MM/DD format (e.g. "2024/12/31"). |
| limit | integer | No | Number of results to return (1-50). Default: 10. |
| publication_type | string | No |
Filter by publication type. Default: "any".
enum: review, clinical-trial, meta-analysis, any |
| query | string | Yes | Search text for biomedical literature (e.g. "COVID-19 vaccine efficacy", "BRCA1 breast cancer"). |
POST /api/v1/tools/education.arxiv_search/call dynamic
Search 2.4M+ preprints in physics, math, CS, biology, and more — full text, authors, categories, PDF links (arXiv)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| author | string | No | Author name to filter by (e.g. "Vaswani", "Hinton"). |
| category | string | No | arXiv category filter (e.g. "cs.AI", "math.CO", "physics.hep-th", "q-bio.GN"). |
| limit | integer | No | Number of results to return (1-50). Default: 10. |
| query | string | Yes | Search text for preprints (e.g. "transformer architecture", "quantum computing"). |
| sort | string | No |
Sort order for results. Default: "relevance".
enum: relevance, lastUpdatedDate, submittedDate |
POST /api/v1/tools/education.doi_lookup/call dynamic
Resolve a DOI to full publication metadata — title, authors, journal, citations, funding, license (CrossRef)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| doi | string | Yes | DOI to resolve (e.g. "10.1038/nature12373", "10.1145/3292500.3330648"). |
POST /api/v1/tools/geo.geocode/call dynamic
Convert an address, place name, or landmark to geographic coordinates (lat/lon) with structured address data (Geoapify/OSM)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | No | ISO 3166-1 alpha-2 country code to filter results (e.g. "US", "DE", "FR"). |
| lang | string | No | Result language code (e.g. "en", "de", "ru"). Default: English. |
| limit | integer | No | Maximum number of results to return (default 1, max 5). |
| text | string | Yes | Address, place name, or landmark to geocode (e.g. "1600 Pennsylvania Ave, Washington DC", "Eiffel Tower"). |
| type | string | No |
Filter by result type: city, street, amenity, or country.
enum: city, street, amenity, country |
POST /api/v1/tools/geo.reverse_geocode/call dynamic
Convert geographic coordinates (lat/lon) to a structured address — street, city, country, postal code (Geoapify/OSM)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lang | string | No | Result language code (e.g. "en", "de", "ru"). Default: English. |
| lat | number | Yes | Latitude of the point to reverse geocode. |
| lon | number | Yes | Longitude of the point to reverse geocode. |
POST /api/v1/tools/geo.place_search/call dynamic
Search points of interest (restaurants, pharmacies, hotels, attractions) near a location by category and radius (Geoapify/OSM)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| categories | string | Yes | POI category filter (e.g. "catering.restaurant", "healthcare.pharmacy", "tourism.attraction", "accommodation.hotel"). Multiple categories separated by comma. |
| lang | string | No | Result language code (e.g. "en", "de", "ru"). Default: English. |
| lat | number | Yes | Center latitude for the search area. |
| limit | integer | No | Maximum number of results (default 20, max 50). |
| lon | number | Yes | Center longitude for the search area. |
| radius | integer | No | Search radius in meters (default 1000, max 50000). |
POST /api/v1/tools/geo.autocomplete/call dynamic
Get autocomplete suggestions as you type an address or place name — for real-time search UX (Geoapify/OSM)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | No | ISO 3166-1 alpha-2 country code to filter results (e.g. "US", "DE"). |
| lang | string | No | Result language code (e.g. "en", "de", "ru"). Default: English. |
| limit | integer | No | Maximum number of suggestions (default 5, max 5). |
| text | string | Yes | Partial address or place name to autocomplete (e.g. "1600 Penn", "Berlin Bran"). |
| type | string | No |
Filter by result type: city, street, amenity, or country.
enum: city, street, amenity, country |
POST /api/v1/tools/geo.routing/call dynamic
Get turn-by-turn driving, walking, cycling, or transit directions between two points with distance and time (Geoapify/OSM)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| dest_lat | number | Yes | Destination latitude (e.g. 48.8566) |
| dest_lon | number | Yes | Destination longitude (e.g. 2.3522) |
| lang | string | No | Turn-by-turn instruction language (e.g. "en", "de"). Default: English. |
| mode | string | No |
Travel mode: drive, walk, bicycle, or transit. Default: drive.
enum: drive, walk, bicycle, transit |
| origin_lat | number | Yes | Start point latitude (e.g. 40.7128) |
| origin_lon | number | Yes | Start point longitude (e.g. -74.0060) |
| units | string | No |
Distance units: metric (km) or imperial (miles). Default: metric.
enum: metric, imperial |
POST /api/v1/tools/geo.isochrone/call dynamic
Get reachability area (isochrone) — polygon showing how far you can travel from a point in a given time or distance (Geoapify/OSM)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| distance | integer | No | Reachability distance in meters (max 100km). Mutually exclusive with time. |
| lat | number | Yes | Center point latitude (e.g. 52.5200) |
| lon | number | Yes | Center point longitude (e.g. 13.4050) |
| mode | string | No |
Travel mode: drive, walk, or bicycle. Default: drive.
enum: drive, walk, bicycle |
| time | integer | No | Reachability time in seconds (default 900 = 15 min, max 7200 = 2h). Mutually exclusive with distance. |
POST /api/v1/tools/geo.ip_geolocation/call dynamic
Geolocate an IP address (IPv4/IPv6) to country, city, coordinates, and network info (Geoapify)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ip | string | Yes | IPv4 or IPv6 address to geolocate (e.g. "8.8.8.8", "2001:4860:4860::8888"). |
POST /api/v1/tools/aipush.setup_website/call dynamic
Register a website for AI marketing. Call with domain + target_url. If DNS is not configured, returns DNS_NOT_VERIFIED with exact CNAME record instructions — relay to user: reference.{domain} → cname.aipush.app. After user creates DNS record, call again. On success: client registered, MIP analysis starts automatically, SSL provisioning begins. Poll website_status until mip_status='ready' and cf_hostname_status='active', then use generate_page. Idempotent (AIPush)
- Amount
- 1.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 1.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| target_url | string | Yes | Target conversion URL — the single page all generated content will link to (e.g. "https://example.com/book", "https://myhotel.com/reserve"). Must be on the same domain. |
| website_domain | string | Yes | Domain of the website to register (e.g. "example.com", "myhotel.com"). Must have a CNAME record: reference.{domain} → cname.aipush.app |
POST /api/v1/tools/aipush.website_status/call dynamic
Poll website readiness after setup_website. Returns billing_status, mip_status ('empty'|'pending'|'ready'), cf_hostname_status, cf_ssl_status, pages_total. Gate your workflow: wait for mip_status='ready' AND cf_hostname_status='active' before calling generate_page. Safe to poll repeatedly (AIPush)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| website_domain | string | Yes | Domain to check status for (e.g. "example.com"). |
POST /api/v1/tools/aipush.generate_page/call dynamic
Requires mip_status='ready' and cf_hostname_status='active' (check website_status first). Generates one AI-optimized HTML page structured for AI assistant answer compilation (ChatGPT, Perplexity, Gemini). Page includes decision question, short answer with CTA, comparison, pricing, FAQ. Published at reference.{domain}/{slug}. Optional keyword parameter targets specific search intent (AIPush)
- Amount
- 0.050000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.050000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| keyword | string | No | Target keyword or topic for the page (e.g. "best hotels in Bangkok", "affordable dentist near me"). If omitted, the system picks from the semantic coverage grid. |
| website_domain | string | Yes | Domain of the website to generate a page for. Must be set up first via aipush.setup_website. |
POST /api/v1/tools/aipush.list_pages/call dynamic
⚡ ACTION: List all published AI marketing pages for a website with URLs, titles, and publish dates (AIPush)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Maximum number of pages to return (default 20, max 100). |
| offset | integer | No | Number of pages to skip for pagination (default 0). |
| website_domain | string | Yes | Domain to list pages for (e.g. "example.com"). |
POST /api/v1/tools/aipush.page_content/call dynamic
Get full HTML content and metadata of a specific generated page by slug (AIPush)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| slug | string | Yes | Page slug identifier (e.g. "best-hotels-bangkok-2026"). Returned by aipush.list_pages or aipush.generate_page. |
| website_domain | string | Yes | Domain the page belongs to (e.g. "example.com"). |
POST /api/v1/tools/aipush.website_profile/call dynamic
Get MIP business analysis results — business name, category, location, competitors, value propositions, and market surface data (AIPush)
- Amount
- 0.010000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.010000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| website_domain | string | Yes | Domain to get the MIP business analysis for. Must have completed setup (mip_status = "ready"). |
POST /api/v1/tools/aipush.check_visibility/call dynamic
Test whether AI assistants (ChatGPT, Perplexity, Gemini) know about and recommend a brand — returns per-model visibility scores (AIPush)
- Amount
- 0.100000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.100000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| website_domain | string | Yes | Domain to check AI visibility for (e.g. "example.com"). Tests whether AI assistants know about and recommend this brand. |
POST /api/v1/tools/aipush.market_report/call dynamic
⚡ ACTION: Start a full AI market intelligence report for any website. Provide a URL (e.g. "https://stripe.com") — the system crawls the site, extracts value propositions and services, identifies competitors, scores them, finds keyword gaps and market opportunities. Returns report_id — poll with aipush.market_report_status. Takes ~2 minutes. Cost: $29.99 (AIPush MIP)
- Amount
- 29.990000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 29.990000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| target_url | string | Yes | Website URL to analyze (e.g. "https://stripe.com"). The system crawls the site, extracts value propositions, finds competitors, and builds a full market intelligence report with competitive scoring, keyword gaps, and market opportunities. Takes ~2 minutes. |
POST /api/v1/tools/aipush.market_report_status/call dynamic
Poll the status of a market intelligence report. Returns "running" with current step (crawling/ai_analysis), or "completed" with full profile_json containing competitors (scored), keywords, market surface, and evidence. Free to poll (AIPush MIP)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| report_id | string | Yes | Report ID in UUID format (e.g. "ed90f49c-15d8-46ee-9799-c6a8d468f6ba") — returned by aipush.market_report. Poll until status = "completed" to get full profile_json with competitors, keywords, and market analysis. |
POST /api/v1/tools/diffbot.product_extract/call dynamic
Extract structured product data from any e-commerce URL — title, price, brand, specs, images, reviews. Works on any retailer without custom integration (Diffbot)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| discussion | boolean | No | Include product reviews and comments (default false) |
| timeout | integer | No | Request timeout in milliseconds (5000-30000, default 15000) |
| url | string | Yes | Product page URL to extract data from (any e-commerce site) |
POST /api/v1/tools/diffbot.page_analyze/call dynamic
Auto-detect page type (product, article, image, video) and extract structured data from any URL using AI (Diffbot)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fallback | string | No |
Fallback extraction type if auto-detection fails
enum: article, product |
| mode | string | No |
Force extraction mode instead of auto-detection
enum: product, article, image, discussion, video |
| timeout | integer | No | Request timeout in milliseconds (5000-30000, default 15000) |
| url | string | Yes | Web page URL to auto-detect type and extract structured data |
POST /api/v1/tools/diffbot.article_extract/call dynamic
Extract article text, author, date, tags, sentiment, and images from any blog or news URL with multi-page support (Diffbot)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| maxTags | integer | No | Maximum number of topic tags to return (1-50, default 10) |
| paging | boolean | No | Follow multi-page articles and concatenate text (default true) |
| timeout | integer | No | Request timeout in milliseconds (5000-30000, default 15000) |
| url | string | Yes | Article or blog post URL to extract text, author, and metadata |
POST /api/v1/tools/diffbot.search/call dynamic
Search Diffbot Knowledge Graph for products, organizations, people, and places — billions of structured entities from the web (Diffbot)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| from | integer | No | Pagination offset for results (default 0) |
| query | string | Yes | Diffbot Knowledge Graph query (DQL) — e.g. "type:Product title:iPhone" |
| size | integer | No | Number of results to return (1-50, default 25) |
| type | string | No |
Filter results by entity type in Knowledge Graph
enum: Product, Article, Organization, Person, Place, Event |
POST /api/v1/tools/whois.lookup/call dynamic
Get WHOIS registration data for any domain — registrar, creation/expiry dates, nameservers, registrant contact, status across 374M+ domains and 7,596 TLDs (WhoisXML)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| check_availability | boolean | No | Also check domain availability status (default false) |
| domain | string | Yes | Domain name, IPv4, IPv6, or email address for WHOIS lookup (e.g. "google.com", "8.8.8.8") |
| include_ips | boolean | No | Include resolved IP addresses for the domain (default false) |
| prefer_fresh | boolean | No | Get latest WHOIS record even if incomplete (default false) |
POST /api/v1/tools/whois.dns_lookup/call dynamic
Get DNS records for a domain — A, AAAA, MX, NS, SOA, TXT, CNAME, SRV, CAA records with TTL and raw data (WhoisXML)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to look up DNS records for (e.g. "google.com") |
| record_type | string | No |
DNS record type to query: A, AAAA, MX, NS, SOA, TXT, CNAME, SRV, CAA, or _all (default _all)
enum: A, AAAA, MX, NS, SOA, TXT, CNAME, SRV, CAA, _all |
POST /api/v1/tools/whois.availability/call dynamic
Check if a domain name is available for registration — fast DNS check or thorough DNS+WHOIS verification (WhoisXML)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to check availability for (e.g. "example.com", "mybrand.io") |
| mode | string | No |
Check mode: DNS_ONLY is fast, DNS_AND_WHOIS is more accurate (default DNS_AND_WHOIS)
enum: DNS_ONLY, DNS_AND_WHOIS |
POST /api/v1/tools/whois.reverse/call dynamic
Find all domains registered by a person, company, or email — reverse WHOIS lookup for OSINT and brand monitoring (WhoisXML)
- Amount
- 0.008000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.008000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| keyword | string | Yes | Search keyword to find domains — registrant name, email, company, or address (e.g. "John Smith", "acme.com") |
POST /api/v1/tools/spoonacular.recipe_search/call dynamic
Search 365K+ recipes with dietary filters (vegan, keto, gluten-free), cuisine, meal type, and max prep time — includes nutrition data per result (Spoonacular)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cuisine | string | No | Cuisine filter — comma-separated (e.g. "italian", "mexican,chinese") |
| diet | string | No | Diet filter: gluten free, ketogenic, vegetarian, lacto-vegetarian, ovo-vegetarian, vegan, pescetarian, paleo, primal, whole30 |
| intolerances | string | No | Intolerances filter — comma-separated (e.g. "dairy,gluten,peanut,shellfish") |
| max_ready_time | integer | No | Maximum preparation time in minutes |
| number | integer | No | Number of results to return (default 10, max 100) |
| offset | integer | No | Offset for pagination (default 0) |
| query | string | No | Search query for recipes (e.g. "pasta", "chicken soup") |
| type | string | No | Meal type: main course, side dish, dessert, appetizer, salad, bread, breakfast, soup, beverage, sauce, marinade, fingerfood, snack, drink |
POST /api/v1/tools/spoonacular.recipe_details/call dynamic
Get full recipe details by ID — ingredients, step-by-step instructions, nutrition facts, dietary labels, prep time, servings, and price per serving (Spoonacular)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | Spoonacular recipe ID (from recipe_search or by_ingredients results) |
POST /api/v1/tools/spoonacular.by_ingredients/call dynamic
Find recipes using ingredients you have on hand — shows used/missing ingredients count, ranked by ingredient match (Spoonacular)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ignore_pantry | boolean | No | Ignore common pantry items like water, flour, salt (default false) |
| ingredients | string | Yes | Comma-separated list of ingredients you have (e.g. "chicken,rice,tomato") |
| number | integer | No | Number of results to return (default 10, max 100) |
| ranking | integer | No | Ranking mode: 1 = maximize used ingredients, 2 = minimize missing ingredients (default 1) |
POST /api/v1/tools/spoonacular.ingredient_search/call dynamic
Search 86K+ food ingredients with nutrition data — sortable by calories, protein, fat, or carbs (Spoonacular)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| number | integer | No | Number of results to return (default 10, max 100) |
| query | string | Yes | Ingredient search query (e.g. "banana", "olive oil", "chicken breast") |
| sort | string | No |
Sort results by nutrient value
enum: calories, protein, fat, carbs |
| sort_direction | string | No |
Sort direction (default asc)
enum: asc, desc |
POST /api/v1/tools/spoonacular.analyze_recipe/call dynamic
Analyze a recipe by title and ingredient list — returns full nutrition breakdown, dietary labels, and caloric distribution (Spoonacular)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ingredients | array | Yes | List of ingredient strings (e.g. ["200g spaghetti", "100g guanciale", "2 eggs"]) |
| instructions | string | No | Cooking instructions as plain text |
| servings | integer | No | Number of servings (default 1) |
| title | string | Yes | Recipe title (e.g. "Spaghetti Carbonara") |
POST /api/v1/tools/nasa.apod/call dynamic
Get NASA Astronomy Picture of the Day — daily curated space image or video with expert explanation, dating back to 1995 (NASA APOD)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | No | Date in YYYY-MM-DD format (default: today). Returns the Astronomy Picture of the Day for that date |
| thumbs | boolean | No | Return thumbnail URL for video APOD entries (default false) |
POST /api/v1/tools/nasa.neo_feed/call dynamic
Get near-Earth asteroid close approaches for a date range — size estimates, hazard classification, velocity, miss distance (NASA NeoWs)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| end_date | string | No | End date in YYYY-MM-DD format (default: start_date + 7 days) |
| start_date | string | Yes | Start date in YYYY-MM-DD format for asteroid feed (max 7-day span) |
POST /api/v1/tools/nasa.donki_flr/call dynamic
Get solar flare events from the Space Weather Database — class, peak time, source region, linked CMEs and geomagnetic storms (NASA DONKI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| end_date | string | No | End date in YYYY-MM-DD format (default: today) |
| start_date | string | No | Start date in YYYY-MM-DD format (default: 30 days ago) |
POST /api/v1/tools/nasa.epic/call dynamic
Get full-disc Earth images from the DSCOVR satellite EPIC camera — daily natural color photos from Lagrange point L1, 1.5M km away (NASA EPIC)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | No | Date in YYYY-MM-DD format (default: most recent available). Returns DSCOVR EPIC Earth images for that date |
POST /api/v1/tools/nasa.image_search/call dynamic
Search NASA Image and Video Library — 140K+ images, videos, and audio from missions, telescopes, and events with metadata and download links (NASA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| media_type | string | No |
Filter by media type (default: all types)
enum: image, video, audio |
| page | integer | No | Page number for pagination (default 1) |
| q | string | Yes | Search query for NASA images and videos (e.g. "mars rover", "apollo 11", "nebula") |
| year_end | integer | No | Filter results to year <= year_end |
| year_start | integer | No | Filter results to year >= year_start |
POST /api/v1/tools/jpl.close_approaches/call dynamic
Get upcoming and past asteroid close approaches to Earth — distance, velocity, size, sorted by date or distance (NASA JPL)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date_max | string | No | Maximum close-approach date in YYYY-MM-DD format (default: +60 days) |
| date_min | string | No | Minimum close-approach date in YYYY-MM-DD format (default: now) |
| dist_max | string | No | Maximum approach distance in AU (e.g. "0.05" = ~7.5M km). Default: 0.05 |
| h_max | number | No | Maximum absolute magnitude H (smaller H = larger object). Filter for brighter/bigger asteroids |
| limit | integer | No | Maximum number of results (default 20, max 100) |
| sort | string | No |
Sort field (default: date)
enum: date, dist, dist-min, h, v-inf, v-rel |
POST /api/v1/tools/jpl.fireballs/call dynamic
Get reported fireball (bolide) events — atmospheric entry energy, velocity, altitude, geographic coordinates (NASA JPL CNEOS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date_max | string | No | Maximum event date in YYYY-MM-DD format |
| date_min | string | No | Minimum event date in YYYY-MM-DD format |
| energy_min | number | No | Minimum radiated energy in Joules (e.g. 1e10) |
| limit | integer | No | Maximum number of results (default 20, max 100) |
| sort | string | No |
Sort field (default: date descending)
enum: date, energy, impact-e, vel, alt |
POST /api/v1/tools/jpl.small_body/call dynamic
Look up asteroid or comet data by name/designation — orbital elements, physical parameters, discovery info, hazard classification (NASA JPL SBDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| des | string | No | SPK-ID or designation for exact lookup (e.g. "99942" for Apophis) |
| phys_par | boolean | No | Include physical parameters like diameter, albedo, rotation period (default true) |
| sstr | string | No | Search string — asteroid/comet name or designation (e.g. "Apophis", "2024 YR4", "Halley") |
POST /api/v1/tools/jpl.impact_risk/call dynamic
Get asteroid impact risk assessments from the Sentry monitoring system — impact probability, Palermo/Torino scale, size estimates (NASA JPL)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| des | string | No | Asteroid designation to check specific object (e.g. "99942" for Apophis). Omit for full list |
| h_max | number | No | Maximum absolute magnitude H — filter for larger objects |
| ip_min | number | No | Minimum impact probability (e.g. 1e-7) |
| ps_min | number | No | Minimum Palermo Scale value (e.g. -3). Higher = more concerning |
POST /api/v1/tools/rawg.game_search/call dynamic
Search 800K+ video games — filter by genre, platform, release date, Metacritic score, with ratings, screenshots, and store links (RAWG)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| dates | string | No | Filter by release date range YYYY-MM-DD,YYYY-MM-DD (e.g. "2024-01-01,2024-12-31") |
| genres | string | No | Filter by genre IDs — comma-separated (e.g. "4" for action, "5" for RPG, "4,5" for both) |
| metacritic | string | No | Filter by Metacritic score range "min,max" (e.g. "80,100" for highly rated) |
| ordering | string | No | Sort field: name, released, added, created, updated, rating, metacritic. Prefix with "-" for descending (e.g. "-rating") |
| page | integer | No | Page number for pagination (default 1) |
| page_size | integer | No | Number of results per page (default 20, max 40) |
| platforms | string | No | Filter by platform IDs — comma-separated (e.g. "4" for PC, "187" for PS5, "186" for Xbox Series) |
| search | string | No | Search query for games (e.g. "The Witcher", "Red Dead Redemption") |
POST /api/v1/tools/rawg.game_details/call dynamic
Get full game details by ID or slug — description, platforms, genres, developers, publishers, ratings, Metacritic score, system requirements (RAWG)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | RAWG game ID (numeric) or slug (e.g. "grand-theft-auto-v", 3498) |
POST /api/v1/tools/rawg.screenshots/call dynamic
Get screenshot images for a game — full resolution URLs with dimensions (RAWG)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | RAWG game ID or slug |
| page | integer | No | Page number (default 1) |
| page_size | integer | No | Results per page (default 20, max 40) |
POST /api/v1/tools/rawg.store_links/call dynamic
Get purchase/download links for a game across stores — Steam, PlayStation Store, Xbox, Epic, GOG, Nintendo (RAWG)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | RAWG game ID or slug |
POST /api/v1/tools/rawg.game_series/call dynamic
Get all games in the same series/franchise — sequels, prequels, and spin-offs with ratings and release dates (RAWG)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | RAWG game ID or slug |
| page | integer | No | Page number (default 1) |
| page_size | integer | No | Results per page (default 20, max 40) |
POST /api/v1/tools/igdb.game_search/call dynamic
Search 280K+ games in IGDB (Twitch) — rich metadata with genres, platforms, ratings, cover art, and release dates
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Maximum number of results to return (default 10, max 50) |
| query | string | Yes | Search query for games (e.g. "Cyberpunk 2077", "The Legend of Zelda", "Elden Ring") |
POST /api/v1/tools/igdb.game_details/call dynamic
Get full game details by IGDB ID — storyline, genres, platforms, developers, publishers, themes, game modes, similar games, and websites
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | IGDB game ID (numeric, e.g. 1877 for Cyberpunk 2077) |
POST /api/v1/tools/igdb.company_info/call dynamic
Look up game companies by ID or search by name — description, country, developed/published game IDs, logos, and websites
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | No | IGDB company ID (numeric, e.g. 70 for Nintendo). Use either id or query. |
| limit | integer | No | Maximum number of results when searching by query (default 10, max 50) |
| query | string | No | Search query for company name (e.g. "Valve", "CD Projekt"). Use either id or query. |
POST /api/v1/tools/igdb.platform_info/call dynamic
Look up gaming platforms by ID or search by name — abbreviation, generation, platform family, versions, and summary
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | No | IGDB platform ID (numeric, e.g. 48 for PlayStation 4, 6 for PC). Use either id or query. |
| limit | integer | No | Maximum number of results when searching by query (default 10, max 50) |
| query | string | No | Search query for platform name (e.g. "PlayStation", "Nintendo Switch"). Use either id or query. |
POST /api/v1/tools/igdb.game_media/call dynamic
Get cover art, screenshots, and video trailers for a game — image URLs with dimensions and YouTube video IDs
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | IGDB game ID (numeric, e.g. 1877 for Cyberpunk 2077) |
POST /api/v1/tools/qrserver.generate/call dynamic
Generate a QR code image URL from text or URL — customizable size, color, background, format (PNG/SVG), error correction level. Returns direct image URL (goqr.me)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| bgcolor | string | No | Background color as 6-digit hex without #, e.g. "ffffff" for white (default: "ffffff") |
| color | string | No | Foreground color as 6-digit hex without #, e.g. "000000" for black (default: "000000") |
| data | string | Yes | Text or URL to encode into a QR code (required) |
| ecc | string | No |
Error correction level: L (7%), M (15%), Q (25%), H (30%) — higher allows more damage tolerance (default: "L")
enum: L, M, Q, H |
| format | string | No |
Image format: "png" or "svg" (default: "png")
enum: png, svg |
| margin | integer | No | Quiet zone margin in modules around the QR code (default: 1) |
| size | string | No | Image size in WxH pixels, e.g. "200x200", "400x400" (default: "200x200") |
POST /api/v1/tools/qrserver.read/call dynamic
Decode a QR code from an image URL — extracts the encoded text or URL from any QR code image (goqr.me)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fileurl | string | Yes | URL of an image containing a QR code to decode (required) |
POST /api/v1/tools/upc.lookup/call dynamic
Look up a product by UPC, EAN, GTIN, or ISBN barcode — returns title, brand, images, dimensions, weight, category, price range, and marketplace offers (UPCitemdb)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| upc | string | Yes | UPC, EAN, GTIN, or ISBN barcode number to look up (e.g. "012345678905", "9780140449136") |
POST /api/v1/tools/upc.search/call dynamic
Search products by name, brand, or description — returns matching items with UPC codes, images, categories, and price ranges (UPCitemdb)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| match_mode | integer | No | Match mode: 0 = broad match (default), 1 = exact match |
| offset | integer | No | Pagination offset for results (default: 0) |
| query | string | Yes | Full-text search query for product name, brand, or description (e.g. "iPhone 16", "Sony headphones") |
| type | string | No |
Search type: "product" (default), "brand", or "category"
enum: product, brand, category |
POST /api/v1/tools/ip.lookup/call dynamic
Look up any IP address — geolocation (country, city, coordinates), 9 security flags (VPN, Tor, proxy, datacenter, abuser, crawler, bogon, mobile, satellite), ASN, company info, abuse contacts (ipapi.is)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ip | string | Yes | IPv4 or IPv6 address to look up (e.g. "8.8.8.8", "2001:4860:4860::8888") |
POST /api/v1/tools/ip.bulk_lookup/call dynamic
Look up multiple IP addresses in one call (max 100) — country, city, VPN/Tor/proxy flags, ASN, and organization for each IP (ipapi.is)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ips | array | Yes | Array of IPv4/IPv6 addresses to look up in bulk (max 100 per request) |
POST /api/v1/tools/earthquake.search/call dynamic
Search global earthquakes by time, location, magnitude, and depth — returns magnitude, coordinates, tsunami flags, PAGER alerts, and felt reports. 100+ years of data, updated every minute (USGS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| alertlevel | string | No |
PAGER alert level filter: green (no damage), yellow, orange, red (significant damage/casualties)
enum: green, yellow, orange, red |
| endtime | string | No | End date in ISO 8601 format (default: now) |
| latitude | number | No | Center latitude for radius search (-90 to 90) |
| limit | integer | No | Maximum number of results (default 20, max 200) |
| longitude | number | No | Center longitude for radius search (-180 to 180) |
| maxdepth | number | No | Maximum depth in kilometers (max 1000) |
| maxmagnitude | number | No | Maximum magnitude on Richter scale |
| maxradiuskm | number | No | Search radius in kilometers from lat/lon center point (max ~20,000 km) |
| mindepth | number | No | Minimum depth in kilometers (negative = above sea level) |
| minmagnitude | number | No | Minimum magnitude on Richter scale (e.g. 4.5 for significant earthquakes) |
| orderby | string | No |
Sort order: "time" (newest first, default), "time-asc", "magnitude" (largest first), "magnitude-asc"
enum: time, time-asc, magnitude, magnitude-asc |
| starttime | string | No | Start date in ISO 8601 format, e.g. "2026-01-01" or "2026-01-01T00:00:00" |
POST /api/v1/tools/earthquake.feed/call dynamic
Get real-time earthquake feed by magnitude threshold (significant/4.5+/2.5+/1.0+/all) and time window (hour/day/week/month) — updated every minute (USGS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| magnitude | string | No |
Magnitude threshold: "significant", "4.5", "2.5", "1.0", or "all" (default: "4.5")
enum: significant, 4.5, 2.5, 1.0, all |
| timeframe | string | No |
Time window: "hour", "day" (default), "week", or "month"
enum: hour, day, week, month |
POST /api/v1/tools/earthquake.count/call dynamic
Count earthquakes matching search criteria without returning full data — useful for statistics and monitoring thresholds (USGS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| endtime | string | No | End date in ISO 8601 format (default: now) |
| latitude | number | No | Center latitude for radius search |
| longitude | number | No | Center longitude for radius search |
| maxmagnitude | number | No | Maximum magnitude on Richter scale |
| maxradiuskm | number | No | Search radius in kilometers from lat/lon center |
| minmagnitude | number | No | Minimum magnitude on Richter scale |
| starttime | string | No | Start date in ISO 8601 format, e.g. "2026-01-01" |
POST /api/v1/tools/anime.search/call dynamic
Search 28K+ anime titles by name, genre, type, status, and rating — scores, episodes, studios, seasons (MyAnimeList via Jikan)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| genre | integer | No | Genre ID filter (e.g. 1=Action, 2=Adventure, 4=Comedy, 8=Drama, 10=Fantasy, 22=Romance) |
| limit | integer | No | Results per page (default: 10, max: 25) |
| order_by | string | No |
Sort field (default: relevance)
enum: title, start_date, end_date, episodes, score, rank, popularity, favorites, members |
| page | integer | No | Page number for pagination (default: 1) |
| query | string | No | Search query for anime title (e.g. "Naruto", "Attack on Titan") |
| rating | string | No |
Age rating: g (all ages), pg, pg13, r17 (violence), r (mild nudity), rx (hentai)
enum: g, pg, pg13, r17, r, rx |
| sort | string | No |
Sort direction: "asc" or "desc" (default: desc)
enum: asc, desc |
| status | string | No |
Airing status: "airing", "complete", or "upcoming"
enum: airing, complete, upcoming |
| type | string | No |
Anime type filter: tv, movie, ova, special, ona, music
enum: tv, movie, ova, special, ona, music, cm, pv, tv_special |
POST /api/v1/tools/anime.details/call dynamic
Get full anime details by MAL ID — synopsis, score, rank, episodes, studios, genres, themes, demographics, rating (MyAnimeList via Jikan)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | MyAnimeList ID of the anime (e.g. 1 for Cowboy Bebop, 20 for Naruto) |
POST /api/v1/tools/manga.details/call dynamic
Get full manga details by MAL ID — synopsis, chapters, volumes, authors, score, rank, genres (MyAnimeList via Jikan)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | MyAnimeList ID of the manga (e.g. 13 for One Piece, 2 for Berserk) |
POST /api/v1/tools/anime.characters/call dynamic
Get character cast and Japanese voice actors for an anime — names, roles (main/supporting), images (MyAnimeList via Jikan)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | MyAnimeList ID of the anime to get character cast for |
POST /api/v1/tools/anime.top/call dynamic
Get top-ranked anime by score — filter by type (TV/movie/OVA), status (airing/upcoming), or popularity (MyAnimeList via Jikan)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No |
Filter: "airing" (currently), "upcoming", "bypopularity", or "favorite"
enum: airing, upcoming, bypopularity, favorite |
| limit | integer | No | Results per page (default: 10, max: 25) |
| page | integer | No | Page number (default: 1) |
| type | string | No |
Filter top list by anime type (default: all types)
enum: tv, movie, ova, special, ona, music, cm, pv, tv_special |
POST /api/v1/tools/books.isbn_lookup/call dynamic
Look up a book by ISBN-10 or ISBN-13 — title, author, publisher, pages, cover image, subjects. 40M+ books (Open Library / Internet Archive)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| isbn | string | Yes | ISBN-10 or ISBN-13 to look up (e.g. "9780451524935" for 1984, "0140449132" for The Republic) |
POST /api/v1/tools/books.search/call dynamic
Search 40M+ books by title, author, subject, or ISBN — ratings, cover images, edition counts, publish year (Open Library / Internet Archive)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| author | string | No | Search by author name (e.g. "Tolkien") |
| isbn | string | No | Search by ISBN number |
| limit | integer | No | Results per page (default: 10, max: 100) |
| page | integer | No | Page number for pagination (default: 1) |
| query | string | No | General search query across title, author, and full text (e.g. "dune frank herbert") |
| sort | string | No |
Sort order: "new" (newest first), "old" (oldest), "rating" (highest rated)
enum: new, old, rating, readinglog, want_to_read, currently_reading, already_read |
| subject | string | No | Search by subject/genre (e.g. "science fiction", "history") |
| title | string | No | Search by book title only (e.g. "The Great Gatsby") |
POST /api/v1/tools/books.work_details/call dynamic
Get consolidated work metadata across all editions by Open Library Work ID — description, subjects, authors, cover, first publish date (Open Library)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| olid | string | Yes | Open Library Work ID, e.g. "OL45804W" for Lord of the Rings. Get from search results key field |
POST /api/v1/tools/books.author/call dynamic
Get author profile by Open Library Author ID — biography, birth/death dates, photo, Wikipedia link (Open Library / Internet Archive)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| olid | string | Yes | Open Library Author ID, e.g. "OL23919A" for J.R.R. Tolkien. Get from search or work author keys |
POST /api/v1/tools/email.validate/call dynamic
Validate an email address — checks deliverability, detects disposable/spam trap/abuse/catch-all addresses, MX records, SMTP provider, domain age. 99.6% accuracy (ZeroBounce)
- Amount
- 0.025000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.025000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| string | Yes | Email address to validate (e.g. "[email protected]") | |
| ip_address | string | No | IP address of the email owner for additional geo/fraud scoring (optional) |
POST /api/v1/tools/shorturl.create/call dynamic
⚡ ACTION: Create a short URL from any long URL. Optional custom slug. Returns short link at apibase.short.gy. 1,000 free links/month (Short.io)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| slug | string | No | Custom short path (e.g. "my-link" → apibase.short.gy/my-link). Auto-generated if omitted. |
| title | string | No | Optional title/label for the short link |
| url | string | Yes | Original URL to shorten (e.g. "https://example.com/very/long/path") |
POST /api/v1/tools/shorturl.stats/call dynamic
Get click statistics and metadata for a short URL by its path (Short.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| path | string | Yes | Short link path (e.g. "imV5of" from apibase.short.gy/imV5of) |
POST /api/v1/tools/exchangerate.latest/call dynamic
Latest exchange rates for 160+ currencies against any base currency. Updated daily on free tier. Returns all rates in one call (ExchangeRate-API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| base | string | No | Base currency code (e.g. "USD", "EUR", "GBP"). Default: USD. Returns rates for 160+ currencies. |
POST /api/v1/tools/exchangerate.convert/call dynamic
Convert amount between any two currencies — 160+ currencies supported. Returns conversion rate and result (ExchangeRate-API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| amount | number | No | Amount to convert (default 1) |
| from | string | Yes | Source currency code (e.g. "USD") |
| to | string | Yes | Target currency code (e.g. "EUR") |
POST /api/v1/tools/calendarific.holidays/call dynamic
Public holidays for 230+ countries — national, local, religious, observance types. Filter by month, day, type. 100+ years coverage. More countries than Nager.Date (Calendarific)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | Yes | ISO 3166-1 alpha-2 country code (e.g. "US", "GB", "DE", "JP", "IN", "BR") |
| day | integer | No | Filter by day (1-31) |
| month | integer | No | Filter by month (1-12) |
| type | string | No |
Filter by holiday type
enum: national, local, religious, observance |
| year | integer | No | Year (default 2026) |
POST /api/v1/tools/weather_alerts.active/call dynamic
Active severe weather alerts for the US — tornado warnings, flood watches, heat advisories, winter storms. Filter by state, severity, event type. US Government open data, unlimited, no auth (NWS/NOAA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| area | string | No | US state code (e.g. "CA", "TX", "NY") or marine zone |
| event | string | No | Event type filter (e.g. "Tornado Warning", "Flood Watch", "Heat Advisory") |
| limit | integer | No | Max alerts to return (default 10, max 50) |
| severity | string | No |
Alert severity filter
enum: Extreme, Severe, Moderate, Minor, Unknown |
| urgency | string | No |
Urgency filter
enum: Immediate, Expected, Future, Past, Unknown |
POST /api/v1/tools/weather_alerts.by_area/call dynamic
Active weather alerts for a specific US state — all warnings, watches, and advisories. Returns event, severity, urgency, description, area, timing (NWS/NOAA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max alerts (default 10, max 50) |
| state | string | Yes | US state code (e.g. "CA", "FL", "TX") |
POST /api/v1/tools/holidays.by_country/call dynamic
Public holidays for any country and year — 100+ countries, national and regional holidays. Returns date, name (local + English), type. No auth, free, open source (Nager.Date)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | Yes | ISO 3166-1 alpha-2 country code (e.g. "US", "GB", "DE", "JP", "BR") |
| year | integer | No | Year (default 2026). Supports 2000-2099. |
POST /api/v1/tools/holidays.next/call dynamic
Next upcoming public holidays for a country — useful for scheduling, availability checks, business day calculations. No auth (Nager.Date)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | Yes | ISO 3166-1 alpha-2 country code (e.g. "US", "FR") |
POST /api/v1/tools/vin.decode/call dynamic
Decode a 17-character VIN — make, model, year, body class, engine, fuel type, transmission, plant country. US Government open data, unlimited, no auth (NHTSA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| vin | string | Yes | 17-character Vehicle Identification Number (e.g. "1HGCM82633A004352") |
POST /api/v1/tools/vin.models/call dynamic
List vehicle models for a make and/or year (e.g. Honda 2024). US Government data (NHTSA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| make | string | No | Vehicle make (e.g. "Honda", "Toyota", "Ford") |
| year | integer | No | Model year (e.g. 2024) |
POST /api/v1/tools/country.search/call dynamic
Search country by name — population, area, capital, languages, currencies, timezones, flag, region, borders. 250+ countries. No auth, free (REST Countries)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| name | string | Yes | Country name to search (e.g. "United States", "Germany", "Japan") |
POST /api/v1/tools/country.by_code/call dynamic
Get country details by ISO code (US, GB, DE, JP). Returns name, population, area, capital, currencies, languages, flag (REST Countries)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| code | string | Yes | ISO 3166-1 country code — alpha-2 ("US") or alpha-3 ("USA") |
POST /api/v1/tools/food.barcode/call dynamic
Lookup food product by barcode (EAN/UPC) — name, brand, nutrition (calories, fat, carbs, protein per 100g), Nutri-Score, NOVA group, ingredients. 3M+ products (Open Food Facts)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| barcode | string | Yes | Product barcode (EAN-13, UPC-A, etc.) e.g. "3017620422003" for Nutella |
POST /api/v1/tools/food.search/call dynamic
Search food products by name — returns matching products with brand, barcode, Nutri-Score, image. 3M+ products worldwide (Open Food Facts)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Results count (default 10, max 50) |
| query | string | Yes | Product name to search (e.g. "nutella", "coca cola", "organic milk") |
POST /api/v1/tools/random.user/call dynamic
Generate realistic random user profiles — name, email, phone, address, age, gender, photo. Filter by nationality and gender. For testing and demo data (RandomUser.me)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| count | integer | No | Number of random users to generate (default 1, max 20) |
| gender | string | No |
Gender filter
enum: male, female |
| nationality | string | No | Nationality filter — comma-separated ISO codes (e.g. "us", "gb,fr,de") |
POST /api/v1/tools/ssl.check/call dynamic
Check SSL/TLS certificate for any domain — validity, issuer, expiry date, days remaining, protocol, key size, HSTS status. No auth, free (ssl-checker.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to check SSL certificate for (e.g. "google.com", "apibase.pro"). Do not include https://. |
POST /api/v1/tools/gdelt.search/call dynamic
Search global news articles across 65 languages from 300K+ sources worldwide. Filter by time, language, tone. Returns title, URL, domain, country. 100% free, no auth (GDELT Project)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| language | string | No | Source language filter (e.g. "english", "spanish", "chinese") |
| limit | integer | No | Number of articles (default 10, max 75) |
| query | string | Yes | Search query — keywords, phrases, or boolean (e.g. "climate change", "AI regulation"). Min 3 chars. |
| sort | string | No |
Sort order: DateDesc (newest), ToneDesc (most positive), HybridRel (relevance)
enum: DateDesc, DateAsc, ToneDesc, ToneAsc, HybridRel |
| timespan | string | No | Time window: "15min", "1h", "4h", "1d", "7d", "30d", "3m" (default: all recent) |
POST /api/v1/tools/gdelt.timeline/call dynamic
Track mention volume of any topic over time — see when a keyword spikes in global news coverage. Up to 3 months of data (GDELT Project)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| query | string | Yes | Query to track mention volume over time (e.g. "Bitcoin", "artificial intelligence") |
| timespan | string | No | Time window: "1d", "7d", "30d", "3m" (default: 3 months) |
POST /api/v1/tools/firms.fires/call dynamic
Active fire hotspots detected by NASA satellites (VIIRS, MODIS) — latitude, longitude, brightness, confidence, fire radiative power. Filter by bounding box and days. Near real-time updates (NASA FIRMS)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| days | integer | No | Number of days of data (1-5, default 1) |
| east | number | Yes | Eastern longitude of bounding box (e.g. -114) |
| north | number | Yes | Northern latitude of bounding box (e.g. 42) |
| source | string | No |
Satellite sensor: VIIRS_SNPP_NRT (default, highest resolution), MODIS_NRT (legacy)
enum: VIIRS_SNPP_NRT, VIIRS_NOAA20_NRT, VIIRS_NOAA21_NRT, MODIS_NRT |
| south | number | Yes | Southern latitude of bounding box (e.g. 32) |
| west | number | Yes | Western longitude of bounding box (e.g. -125 for California) |
POST /api/v1/tools/worldclock.current/call dynamic
Get current date, time, and day of week for any IANA timezone. DST-aware. No auth, free, unlimited (TimeAPI.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| timezone | string | Yes | IANA timezone name (e.g. "America/New_York", "Europe/London", "Asia/Tokyo", "UTC") |
POST /api/v1/tools/worldclock.convert/call dynamic
Convert date/time from one timezone to another. DST-aware. 597 IANA timezones (TimeAPI.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| datetime | string | Yes | Date and time to convert in "YYYY-MM-DD HH:mm:ss" format (e.g. "2026-03-20 12:00:00") |
| from_timezone | string | Yes | Source IANA timezone (e.g. "America/New_York") |
| to_timezone | string | Yes | Target IANA timezone (e.g. "Asia/Tokyo") |
POST /api/v1/tools/worldclock.zones/call dynamic
List all 597 IANA timezone names. Use for timezone validation and discovery (TimeAPI.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No | Optional prefix filter for timezone names (e.g. "America", "Europe", "Asia"). Returns all 597 zones if omitted. |
POST /api/v1/tools/screenshot.capture/call dynamic
⚡ ACTION: Take a screenshot of any URL — returns image URL. Chrome-based rendering, supports full-page capture, custom viewport, ad blocking, cookie banner removal. Waits for JS-heavy SPAs to load (ApiFlash)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| delay | integer | No | Wait N seconds before capture (0-10, for JS-heavy pages) |
| format | string | No |
Image format: "png" (default), "jpeg", or "webp"
enum: png, jpeg, webp |
| full_page | boolean | No | Capture full page scroll height (default false) |
| height | integer | No | Viewport height in pixels (default 1080) |
| no_ads | boolean | No | Block ads before capture (default false) |
| no_cookie_banners | boolean | No | Remove cookie consent banners (default false) |
| url | string | Yes | URL of the website to screenshot (e.g. "https://example.com") |
| wait_until | string | No |
"page_loaded" (default) or "network_idle" (wait for all XHR/fetch)
enum: page_loaded, network_idle |
| width | integer | No | Viewport width in pixels (default 1920, max 3840) |
POST /api/v1/tools/sports.football_fixtures/call dynamic
Football/soccer fixtures, live scores, and results — filter by date, league (Premier League, La Liga, Champions League...), team. 2000+ leagues, 171 countries. 362+ fixtures per day (API-Sports)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | No | Date in YYYY-MM-DD format (e.g. "2026-03-20"). Returns all fixtures for that day. |
| league | integer | No | League ID (e.g. 39 = Premier League, 140 = La Liga, 78 = Bundesliga) |
| live | boolean | No | Set to true to get only live/in-play fixtures |
| season | integer | No | Season year (e.g. 2025) |
| team | integer | No | Team ID to filter fixtures |
POST /api/v1/tools/sports.football_standings/call dynamic
League table/standings — rank, points, wins, draws, losses, goals for/against. All major leagues: Premier League (39), La Liga (140), Bundesliga (78), Serie A (135), Ligue 1 (61) (API-Sports)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| league | integer | Yes | League ID (e.g. 39 = Premier League, 140 = La Liga, 135 = Serie A) |
| season | integer | No | Season year (default: current season, e.g. 2025) |
POST /api/v1/tools/sports.football_leagues/call dynamic
Search football leagues and cups by country or name. Returns league ID, name, type (league/cup), country, logo. Use IDs for fixtures and standings queries (API-Sports)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | Country name to filter leagues (e.g. "England", "Spain", "Germany") |
| search | string | No | Search league by name (e.g. "Premier", "Champions") |
POST /api/v1/tools/sports.basketball_games/call dynamic
Basketball games and scores — NBA, EuroLeague, and 100+ leagues worldwide. Filter by date, league, season, team. Live and historical data (API-Sports)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | No | Date in YYYY-MM-DD format. Returns all basketball games for that day. |
| league | integer | No | League ID (e.g. 12 = NBA) |
| season | string | No | Season (e.g. "2025-2026") |
| team | integer | No | Team ID to filter games |
POST /api/v1/tools/langbly.translate/call dynamic
Translate text between 90+ languages — auto-detects source language, supports batch translation (array of strings), HTML format preservation. Google Translate v2 compatible. $5/1M chars (Langbly)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| format | string | No |
Input format: "text" (default) or "html" (preserves HTML tags)
enum: text, html |
| source | string | No | Source language code (auto-detected if omitted) |
| target | string | Yes | Target language code (e.g. "es", "fr", "de", "ja", "zh", "ru", "ar") |
| text | string | Yes | Text to translate — single string or array of strings for batch translation |
POST /api/v1/tools/langbly.detect/call dynamic
Detect the language of text — returns language code and confidence score. Supports batch detection (Langbly)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| text | string | Yes | Text to detect language of — single string or array |
POST /api/v1/tools/langbly.languages/call dynamic
List all 90+ supported translation languages with localized names. Specify display_language to get names in that language (Langbly)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| display_language | string | No | Language code to display names in (e.g. "en" returns "Spanish", "es" returns "Español") |
POST /api/v1/tools/twilio.lookup/call dynamic
Validate and look up phone number info — format validation, country, national format. Optional: carrier name, line type (mobile/landline/VoIP), caller name CNAM (Twilio)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| include_caller_name | boolean | No | Include caller name CNAM lookup (costs extra credit). US numbers only. |
| include_carrier | boolean | No | Include carrier/line type info (costs extra credit). Returns carrier name, line type (mobile/landline/voip). |
| phone_number | string | Yes | Phone number in E.164 format (e.g. "+14157012311", "+442071234567") |
POST /api/v1/tools/twilio.send_sms/call dynamic
⚡ ACTION: Send SMS message to any phone number worldwide. Requires a Twilio phone number as sender. Returns message SID and delivery status. $0.0083/SMS US outbound (Twilio)
- Amount
- 0.015000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.015000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| body | string | Yes | SMS message text (max 1600 chars, splits into multiple segments if >160) |
| from | string | Yes | Sender phone number — must be a Twilio number you own (e.g. "+15551234567") |
| to | string | Yes | Recipient phone number in E.164 format (e.g. "+14155551234") |
POST /api/v1/tools/stability.generate/call dynamic
⚡ ACTION: Generate images from text prompts using Stable Diffusion — supports style presets (anime, cinematic, pixel-art, photographic...), aspect ratios, negative prompts. Returns base64 PNG data URI. Powered by Stability AI
- Amount
- 0.070000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.070000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| aspect_ratio | string | No |
Image aspect ratio (default "1:1")
enum: 1:1, 16:9, 21:9, 2:3, 3:2, 4:5, 5:4, 9:16, 9:21 |
| negative_prompt | string | No | What to exclude from the image (e.g. "blurry, low quality, text, watermark") |
| prompt | string | Yes | Text prompt describing the image to generate (e.g. "a futuristic city at sunset, cyberpunk style, detailed") |
| style_preset | string | No |
Style preset to guide generation
enum: 3d-model, analog-film, anime, cinematic, comic-book, digital-art, enhance, fantasy-art, isometric, line-art, low-poly, neon-punk, origami, photographic, pixel-art, tile-texture |
POST /api/v1/tools/resend.send_email/call dynamic
⚡ ACTION: Send transactional email — plain text or HTML body, multiple recipients, reply-to. Requires verified sender domain. 3,000 free emails/month (Resend)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| from | string | No | Sender email (default: [email protected]). Must be a verified domain. |
| html | string | No | HTML email body (alternative to text) |
| reply_to | string | No | Reply-to email address |
| subject | string | Yes | Email subject line |
| text | string | No | Plain text email body |
| to | string | Yes | Recipient email address(es) — single email or array of emails |
POST /api/v1/tools/resend.email_status/call dynamic
Check delivery status of a sent email by ID — last event, timestamps (Resend)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| email_id | string | Yes | Email ID returned from send_email (e.g. "d1c6e0a8-...") |
POST /api/v1/tools/mastodon.trending/call dynamic
Trending posts on Mastodon (Fediverse) — popular content across the decentralized social network. Returns post text, author, reblogs, favourites, replies. No auth needed, $0 upstream (Mastodon.social)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of trending posts to return (default 10, max 40) |
POST /api/v1/tools/mastodon.trending_tags/call dynamic
Trending hashtags on Mastodon — top topics with usage counts. Track social media trends on the decentralized network. No auth needed (Mastodon.social)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of trending hashtags to return (default 10, max 20) |
POST /api/v1/tools/regulations.search/call dynamic
Search US federal regulatory documents — rules, proposed rules, notices, presidential documents. Filter by agency (EPA, SEC, FDA...), document type, date. 7,500+ results for "artificial intelligence" (Regulations.gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| agency | string | No | Filter by agency ID (e.g. "EPA", "SEC", "FDA") |
| document_type | string | No |
Filter by document type
enum: Rule, Proposed Rule, Notice, Presidential Document |
| limit | integer | No | Number of results (default 10, min 5, max 25) |
| posted_after | string | No | Only documents posted after this date (YYYY-MM-DD) |
| query | string | No | Search keywords in federal regulatory documents (e.g. "artificial intelligence", "climate change") |
| sort | string | No |
Sort order (default: -postedDate, newest first)
enum: postedDate, -postedDate, title, documentId |
POST /api/v1/tools/regulations.document/call dynamic
Get full details of a US federal regulatory document by ID — title, abstract, agency, comment count, docket, dates. Public domain (Regulations.gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| document_id | string | Yes | Document ID from search results (e.g. "FDA-2024-N-0001-0001") |
POST /api/v1/tools/fedregister.search/call dynamic
Search the US Federal Register — final rules, proposed rules, notices, executive orders. Filter by agency, type, date. 90+ years of official federal government records (Federal Register)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| agency | string | No | Agency slug (e.g. "environmental-protection-agency", "securities-and-exchange-commission") |
| document_type | string | No |
Type: RULE (final rule), PRORULE (proposed rule), NOTICE, PRESDOCU (presidential document/executive order)
enum: RULE, PRORULE, NOTICE, PRESDOCU |
| limit | integer | No | Number of results (default 10, max 20) |
| published_after | string | No | Only documents published after this date (MM/DD/YYYY) |
| query | string | No | Search keywords in Federal Register (e.g. "executive order", "cryptocurrency regulation") |
| sort | string | No |
Sort order (default: newest)
enum: newest, oldest, relevance |
POST /api/v1/tools/fedregister.document/call dynamic
Get full Federal Register document by number — title, abstract, agencies, effective date, PDF link, comment deadline (Federal Register)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| document_number | string | Yes | Federal Register document number (e.g. "2026-12345") |
POST /api/v1/tools/fedregister.recent/call dynamic
Latest documents published in the Federal Register — filter by type (rules, proposed rules, notices, presidential). No search query needed (Federal Register)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| document_type | string | No |
Filter by type (default: all types)
enum: RULE, PRORULE, NOTICE, PRESDOCU |
| limit | integer | No | Number of results (default 10, max 20) |
POST /api/v1/tools/courtlistener.search/call dynamic
Search US federal and state court opinions — filter by court (scotus, ca9, dcd...), date range, relevance. Largest free US case law archive. 7,000+ AI-related opinions (CourtListener / Free Law Project)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| court | string | No | Court filter (e.g. "scotus" for Supreme Court, "ca9" for 9th Circuit, "dcd" for DC District) |
| filed_after | string | No | Only cases filed after this date (YYYY-MM-DD) |
| filed_before | string | No | Only cases filed before this date (YYYY-MM-DD) |
| limit | integer | No | Number of results (default 10, max 20) |
| order_by | string | No |
Sort: relevance (default), newest, oldest
enum: score desc, dateFiled desc, dateFiled asc |
| query | string | Yes | Search query for US court opinions (e.g. "artificial intelligence liability", "Fourth Amendment digital privacy") |
| type | string | No |
Search type: "o" (opinions, default) or "r" (RECAP dockets)
enum: o, r |
POST /api/v1/tools/courtlistener.opinion/call dynamic
Get full text of a US court opinion by ID — author, type, date, download URL. Up to 5,000 characters of opinion text (CourtListener)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| opinion_id | string | Yes | Opinion ID from search results |
POST /api/v1/tools/courtlistener.dockets/call dynamic
Search PACER/RECAP federal court dockets — case filings, motions, orders. Filter by court. From the RECAP Archive (CourtListener / Free Law Project)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| court | string | No | Court filter |
| limit | integer | No | Number of results (default 10) |
| query | string | Yes | Search query for RECAP dockets |
POST /api/v1/tools/ocr.extract_text/call dynamic
Extract text from any image or PDF URL using OCR — supports 20+ languages including English, Russian, Chinese, Japanese, Korean, Arabic. Returns recognized text. Handles PNG, JPG, GIF, BMP, PDF, TIFF (OCR.space)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| detect_orientation | boolean | No | Auto-detect and correct image orientation (default false) |
| filetype | string | No |
File type hint — set if URL has no extension or content-type is wrong
enum: PNG, JPG, GIF, BMP, PDF, TIFF |
| language | string | No |
OCR language: "eng" (English, default), "rus" (Russian), "ger" (German), "fre" (French), "spa" (Spanish), "jpn" (Japanese), "kor" (Korean), "chs" (Chinese Simplified)
enum: eng, ara, chs, cht, dan, dut, fin, fre, ger, gre, hun, ita, jpn, kor, nor, pol, por, rus, spa, swe, tur |
| url | string | Yes | URL of the image or PDF to extract text from (PNG, JPG, GIF, BMP, PDF, TIFF supported) |
POST /api/v1/tools/finnhub.quote/call dynamic
Real-time stock price quote — current price, change, percent change, day high/low, open, previous close. Supports US stocks, ETFs, and major global exchanges (Finnhub)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| symbol | string | Yes | Stock ticker symbol (e.g. "AAPL", "GOOGL", "TSLA", "MSFT") |
POST /api/v1/tools/finnhub.company_profile/call dynamic
Company profile by ticker — name, exchange, industry, country, market cap, shares outstanding, IPO date, logo, website (Finnhub)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| symbol | string | Yes | Stock ticker symbol (e.g. "AAPL") |
POST /api/v1/tools/finnhub.company_news/call dynamic
Latest news articles about a specific company — headline, source, summary, date, image. Filter by date range (Finnhub)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| from | string | No | Start date in YYYY-MM-DD format (default: 7 days ago) |
| symbol | string | Yes | Stock ticker symbol (e.g. "AAPL") |
| to | string | No | End date in YYYY-MM-DD format (default: today) |
POST /api/v1/tools/finnhub.candles/call dynamic
Historical OHLCV candlestick data — open, high, low, close, volume with configurable resolution (1min to monthly). Use for charting and technical analysis (Finnhub)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| from | integer | No | Start timestamp (Unix seconds). Default: 30 days ago |
| resolution | string | No |
Candle resolution: "1","5","15","30","60" (minutes), "D" (day), "W" (week), "M" (month). Default: "D"
enum: 1, 5, 15, 30, 60, D, W, M |
| symbol | string | Yes | Stock ticker symbol (e.g. "AAPL") |
| to | integer | No | End timestamp (Unix seconds). Default: now |
POST /api/v1/tools/finnhub.market_news/call dynamic
General market news — categories: general, forex, crypto, merger. Top headlines with source, summary, and images (Finnhub)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No |
News category: "general" (default), "forex", "crypto", "merger"
enum: general, forex, crypto, merger |
POST /api/v1/tools/news.latest/call dynamic
Latest news from 180,000+ sources across 200+ countries in 70+ languages. Filter by keyword, country, category, language, domain, and recency. Returns title, link, description, source, sentiment, keywords (NewsData.io)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No | Category filter, comma-separated: business, entertainment, environment, food, health, politics, science, sports, technology, top, tourism, world |
| country | string | No | Country code filter, comma-separated (e.g. "us", "gb,de,fr"). 200+ countries supported. |
| domain | string | No | Filter by source domain (e.g. "bbc.co.uk", "nytimes.com") |
| language | string | No | Language code filter (e.g. "en", "de", "fr", "es"). 70+ languages supported. |
| q | string | No | Search keywords in article title and content (e.g. "AI agents", "climate change") |
| size | integer | No | Number of articles to return (default 10, max 50) |
| timeframe | string | No | Recency filter in hours (e.g. "24" for last 24 hours, "1" for last hour) |
POST /api/v1/tools/news.crypto/call dynamic
Cryptocurrency and blockchain news feed — filter by coin (Bitcoin, Ethereum, Solana...), keyword, language. Dedicated crypto news index from specialized sources (NewsData.io)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| coin | string | No | Specific coin filter (e.g. "Bitcoin", "Ethereum", "Solana") |
| language | string | No | Language code (e.g. "en") |
| q | string | No | Search keywords in crypto news (e.g. "Bitcoin ETF", "DeFi") |
| size | integer | No | Number of articles (default 10, max 50) |
POST /api/v1/tools/news.sources/call dynamic
Browse available news sources — filter by country, language, and category. Returns source name, URL, categories, and languages covered. 180,000+ sources indexed (NewsData.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No | Category to filter sources (e.g. "technology", "business") |
| country | string | No | Country code to filter sources (e.g. "us", "gb") |
| language | string | No | Language code to filter sources (e.g. "en") |
POST /api/v1/tools/exa.search/call dynamic
Neural/semantic web search — finds conceptually related pages, not just keyword matches. Supports category filters (company, research paper, news, people, tweet), domain filtering, date range. Returns relevance scores and highlighted excerpts (Exa)
- Amount
- 0.012000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.012000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No |
Category filter for specialized indexes (optional)
enum: company, research paper, news, people, tweet |
| end_published_date | string | No | Filter: only results published before this date |
| exclude_domains | array | No | Exclude results from these domains |
| include_domains | array | No | Only include results from these domains (e.g. ["arxiv.org"]) |
| include_highlights | boolean | No | Include key sentence highlights (default true) |
| include_text | boolean | No | Include full extracted page text in results (default false — saves tokens) |
| num_results | integer | No | Number of results (default 10, max 25) |
| query | string | Yes | Natural language search query — Exa finds semantically related pages, not just keyword matches |
| start_published_date | string | No | Filter: only results published after this date (ISO format, e.g. "2025-01-01") |
| type | string | No |
Search type: "auto" (balanced), "neural" (semantic similarity), "keyword" (traditional). Default: auto
enum: auto, neural, keyword |
POST /api/v1/tools/exa.contents/call dynamic
Extract clean text content from up to 10 URLs — returns title, author, published date, full text. Use for feeding web pages into agent context (Exa)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| urls | array | Yes | URLs to extract content from (1-10). Returns clean text, title, author, date. |
POST /api/v1/tools/exa.find_similar/call dynamic
Find web pages semantically similar to a given URL — discover related content, competitors, alternatives without knowing what to search for. Unique capability for research agents (Exa)
- Amount
- 0.012000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.012000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| exclude_source_domain | boolean | No | Exclude results from same domain as input URL (default true) |
| include_text | boolean | No | Include full extracted page text (default false) |
| num_results | integer | No | Number of similar pages (default 10, max 25) |
| start_published_date | string | No | Only include similar pages published after this date (ISO format) |
| url | string | Yes | Reference URL — Exa finds pages semantically similar to this one |
POST /api/v1/tools/tavily.search/call dynamic
AI-optimized web search — returns synthesized answer + curated results with extracted page content and relevance scores. Built for LLM/agent RAG pipelines. Supports domain filtering and recency (Tavily)
- Amount
- 0.010000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.010000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| days | integer | No | Recency filter — only include results from the last N days |
| exclude_domains | array | No | Exclude results from these domains (e.g. ["reddit.com"]) |
| include_answer | boolean | No | Include AI-synthesized answer based on search results (default true) |
| include_domains | array | No | Only include results from these domains (e.g. ["wikipedia.org", "arxiv.org"]) |
| max_results | integer | No | Number of results to return (default 5, max 20) |
| query | string | Yes | Search query — Tavily returns AI-synthesized answer + curated results with extracted content |
| search_depth | string | No |
Search depth: "basic" (faster, 1 credit) or "advanced" (deeper, 2 credits). Default: basic
enum: basic, advanced |
POST /api/v1/tools/tavily.extract/call dynamic
Extract clean readable content from up to 20 URLs — returns text, title, author, published date. Eliminates scraping. Perfect for feeding web pages into agent context windows (Tavily)
- Amount
- 0.010000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.010000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| urls | array | Yes | URLs to extract clean content from (1-20 URLs). Returns readable text, title, author, date. |
POST /api/v1/tools/serper.web_search/call dynamic
Real-time Google web search results — organic listings, knowledge graph, answer box, people also ask, related searches. Supports country and language targeting. Powered by Serper.dev
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| gl | string | No | Country code for localized results (e.g. "us", "gb", "de", "fr") |
| hl | string | No | Language code for results (e.g. "en", "de", "fr", "es") |
| num | integer | No | Number of results to return (default 10, max 100) |
| page | integer | No | Page number for pagination (default 1) |
| q | string | Yes | Search query (e.g. "best restaurants in Berlin", "how does MCP protocol work") |
POST /api/v1/tools/serper.news_search/call dynamic
Real-time Google News articles — title, source, date, snippet, image. Filter by time (past hour/day/week/month). Global coverage in 70+ languages (Serper.dev)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| gl | string | No | Country code for localized news (e.g. "us", "gb") |
| hl | string | No | Language code (e.g. "en", "de") |
| num | integer | No | Number of articles (default 10, max 100) |
| q | string | Yes | News search query (e.g. "AI agents", "Base network") |
| tbs | string | No | Time filter: "qdr:h" (past hour), "qdr:d" (past day), "qdr:w" (past week), "qdr:m" (past month) |
POST /api/v1/tools/serper.image_search/call dynamic
Google Image search results — image URL, thumbnail, dimensions, source domain. Search any visual content worldwide (Serper.dev)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| gl | string | No | Country code (e.g. "us") |
| num | integer | No | Number of images (default 10, max 100) |
| q | string | Yes | Image search query (e.g. "golden gate bridge sunset") |
POST /api/v1/tools/serper.shopping_search/call dynamic
Google Shopping product listings — title, price, source, rating, delivery info, product images. Compare prices across retailers (Serper.dev)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| gl | string | No | Country code for localized prices (e.g. "us", "gb") |
| num | integer | No | Number of products (default 10, max 100) |
| q | string | Yes | Product search query (e.g. "macbook pro 16 inch", "wireless headphones") |
POST /api/v1/tools/usrealestate.for_sale/call dynamic
Search active for-sale property listings across the US — filter by city, state, ZIP, price range, bedrooms, bathrooms, sqft, property type. Returns address, price, specs, photos. Millions of MLS listings (RapidAPI / Realtor.com data)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| baths_min | integer | No | Minimum number of bathrooms |
| beds_min | integer | No | Minimum number of bedrooms |
| city | string | No | City name, e.g. "Austin" (use with state_code) |
| limit | integer | No | Number of results (default 10, max 42) |
| offset | integer | No | Pagination offset (default 0) |
| postal_code | string | No | ZIP code, e.g. "78701" (alternative to city+state) |
| price_max | integer | No | Maximum listing price in USD |
| price_min | integer | No | Minimum listing price in USD |
| property_type | string | No |
Property type filter
enum: single_family, multi_family, condo, townhomes, mobile, land, farm |
| sort | string | No |
Sort order (default: relevant)
enum: relevant, newest, price_low, price_high, open_house_date, sqft_high, price_reduced_date |
| sqft_min | integer | No | Minimum square footage |
| state_code | string | No | Two-letter US state code, e.g. "TX" |
POST /api/v1/tools/usrealestate.property_detail/call dynamic
Detailed property information by property ID — beds, baths, sqft, year built, lot size, tax assessment, HOA, days on market, photos, last sale price/date. Use for_sale search first to get property_id (RapidAPI / Realtor.com data)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| property_id | string | Yes | Property ID from a for_sale search result (e.g. "2734304997") |
POST /api/v1/tools/usrealestate.location_suggest/call dynamic
Autocomplete location search for US real estate — returns matching cities, ZIP codes, and addresses with coordinates. Use to find valid city/state codes for property searches (RapidAPI / Realtor.com data)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| query | string | Yes | Location search query — city name, address, or ZIP code (e.g. "Austin TX", "90210") |
POST /api/v1/tools/walkscore.score/call dynamic
Walk Score (0-100), Transit Score (0-100), and Bike Score (0-100) for any US/Canada address. Measures walkability to amenities, public transit quality, and cycling infrastructure. Industry-standard walkability metric used by 30,000+ websites (Walk Score / Redfin)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| address | string | Yes | Full street address, e.g. "1119 8th Avenue Seattle WA 98101" |
| latitude | number | Yes | Latitude of the address (-90 to 90). Use geo.geocode to get coordinates. |
| longitude | number | Yes | Longitude of the address (-180 to 180). Use geo.geocode to get coordinates. |
POST /api/v1/tools/airquality.city/call dynamic
Real-time air quality index (AQI US + CN), pollutant concentrations (PM2.5, PM10, O3, NO2, SO2, CO), dominant pollutant, temperature, humidity, wind speed for any city worldwide. 30,000+ monitoring stations across 10,000+ cities (IQAir AirVisual)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| city | string | Yes | City name (e.g. "Los Angeles", "London", "Tokyo") |
| country | string | Yes | Country name (e.g. "USA", "UK", "Japan") |
| state | string | Yes | State or province (e.g. "California", "England", "Tokyo") |
POST /api/v1/tools/airquality.nearest/call dynamic
Real-time air quality index (AQI) and weather data for the nearest monitoring station to given GPS coordinates. Returns nearest city, AQI (US + CN), dominant pollutant, PM2.5/PM10/O3 concentrations, temperature, humidity (IQAir AirVisual)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lat | number | Yes | Latitude (-90 to 90, e.g. 34.0522) |
| lon | number | Yes | Longitude (-180 to 180, e.g. -118.2437) |
POST /api/v1/tools/fatsecret.food_search/call dynamic
Search 2.3M+ food items by name — branded products, restaurant meals, generic foods from 190+ countries. Returns food ID, name, type, brand, and per-serving summary (calories, fat, carbs, protein). Use food_id for detailed nutritional lookup (FatSecret)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| max_results | integer | No | Results per page (default 20, max 50) |
| page | integer | No | Page number for pagination (default 0) |
| query | string | Yes | Food name to search (e.g. "chicken breast", "banana", "greek yogurt") |
POST /api/v1/tools/fatsecret.food_details/call dynamic
Complete nutritional profile for a food item by FatSecret ID — all serving sizes with calories, total/saturated/trans fat, cholesterol, sodium, potassium, carbs, fiber, sugar, protein, vitamins A/C/D, calcium, iron. 2.3M+ foods (FatSecret)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| food_id | string | Yes | FatSecret food ID from search results (e.g. "33691" for chicken breast) |
POST /api/v1/tools/autodev.vin_decode/call dynamic
Decode any VIN worldwide (100+ countries) — make, model, year, trim, engine, transmission, drive type, body style, origin country, manufacturer. Covers EU, Asia, and other markets beyond US-only NHTSA. Static data cached 24h (Auto.dev)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| vin | string | Yes | 17-character Vehicle Identification Number (e.g. "WP0AF2A99KS165242" for Porsche, "WBAFR7C51BC603689" for BMW) |
POST /api/v1/tools/pexels.search_photos/call dynamic
Search curated free stock photos by keyword — filter by orientation (landscape/portrait/square), color, size. Returns multiple resolutions (original to tiny), photographer name, Pexels URL. Free for commercial use (Pexels)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| color | string | No | Color filter (e.g. "red", "blue", "green", "yellow", "orange", "white", "black") |
| limit | integer | No | Results per page (default 10, max 80) |
| orientation | string | No |
Photo orientation filter
enum: landscape, portrait, square |
| page | integer | No | Page number for pagination |
| query | string | Yes | Search term (e.g. "sunset beach", "office meeting", "technology") |
| size | string | No |
Minimum photo size
enum: large, medium, small |
POST /api/v1/tools/pexels.search_videos/call dynamic
Search free stock videos by keyword — returns HD/SD video files with dimensions, duration, download URLs. Free for commercial use (Pexels)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Results per page (default 10, max 80) |
| orientation | string | No |
Video orientation
enum: landscape, portrait, square |
| query | string | Yes | Search term for videos (e.g. "nature timelapse", "city traffic", "cooking") |
| size | string | No |
Minimum video size
enum: large, medium, small |
POST /api/v1/tools/pexels.curated/call dynamic
Hand-picked high-quality curated photos from Pexels — updated daily. Returns photographer, multiple sizes, Pexels URL. Perfect for featured images and hero sections (Pexels)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of curated photos (default 10, max 80) |
| page | integer | No | Page number |
POST /api/v1/tools/browser.create_session/call dynamic
⚡ ACTION: Create a managed headless browser session on Browserbase infrastructure. Returns session ID and WebSocket connect URL for Puppeteer/Playwright. Choose region (US/EU/Asia) and optional residential proxy. Sessions auto-expire after 5 minutes of inactivity (Browserbase)
- Amount
- 0.010000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.010000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| proxy | boolean | No | Use residential proxy for the session (default false) |
| region | string | No |
Browser region (default us-west-2)
enum: us-west-2, us-east-1, eu-central-1, ap-southeast-1 |
POST /api/v1/tools/browser.session_status/call dynamic
Check the status of a Browserbase session — running, completed, error, timed out. Returns CPU usage, memory, proxy bytes, start/end times (Browserbase)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| session_id | string | Yes | Browserbase session ID (from create_session result) |
POST /api/v1/tools/browser.session_content/call dynamic
Get files downloaded during a browser session — screenshots, PDFs, extracted data (Browserbase)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| session_id | string | Yes | Session ID to get downloads/content from |
POST /api/v1/tools/browser.list_sessions/call dynamic
List active or recent browser sessions — filter by status (running, completed, error). Returns session IDs, regions, start times (Browserbase)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| status | string | No |
Filter by session status (default RUNNING)
enum: RUNNING, ERROR, TIMED_OUT, COMPLETED |
POST /api/v1/tools/telegram.send_message/call dynamic
⚡ ACTION: Send a text message to a Telegram user or group chat. Supports Markdown (*bold*, _italic_, `code`, [link](url)) and HTML formatting. Max 4096 chars. Perfect for alerts, notifications, reports (Telegram Bot API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| chat_id | string | Yes | Telegram chat ID (number) or @channel_username (string). Get from get_updates or manually |
| disable_notification | boolean | No | Send silently without notification sound (default false) |
| parse_mode | string | No |
Text formatting: "Markdown" or "HTML" (default plain text)
enum: Markdown, HTML |
| text | string | Yes | Message text (max 4096 chars). Supports Markdown: *bold*, _italic_, `code`, [link](url) |
POST /api/v1/tools/telegram.send_photo/call dynamic
⚡ ACTION: Send a photo to a Telegram chat with optional caption. Provide image URL — supports JPG, PNG, GIF up to 10MB (Telegram Bot API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| caption | string | No | Photo caption (max 1024 chars) |
| chat_id | string | Yes | Target chat ID or @channel_username |
| photo | string | Yes | Photo URL (https://...) or Telegram file_id from previous upload |
POST /api/v1/tools/telegram.send_document/call dynamic
⚡ ACTION: Send a file/document to a Telegram chat — PDF, CSV, ZIP, any format up to 50MB. Perfect for sending reports, data exports, generated files (Telegram Bot API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| caption | string | No | Document caption |
| chat_id | string | Yes | Target chat ID or @channel_username |
| document | string | Yes | Document URL (https://...) — PDF, CSV, ZIP, etc. |
POST /api/v1/tools/telegram.get_updates/call dynamic
Get recent incoming messages and events for the bot — new messages, user info, chat type. Use offset to get only new updates since last check (Telegram Bot API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of updates to retrieve (default 10, max 100) |
| offset | integer | No | Update ID offset — pass last update_id + 1 to get only new updates |
POST /api/v1/tools/telegram.get_chat/call dynamic
Get info about a Telegram chat — title, type (private/group/supergroup/channel), description, member count, invite link, username (Telegram Bot API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| chat_id | string | Yes | Chat ID or @username to get info about |
POST /api/v1/tools/clinical.search/call dynamic
Search 577,000+ clinical trials worldwide — filter by condition (cancer, diabetes), intervention (drug name), sponsor, status (recruiting/completed), phase. Returns NCT ID, title, status, conditions, interventions, sponsor, enrollment. US National Library of Medicine (ClinicalTrials.gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| condition | string | No | Filter by medical condition (e.g. "Breast Cancer", "Alzheimer", "Type 2 Diabetes") |
| intervention | string | No | Filter by drug/device/procedure name (e.g. "aspirin", "pacemaker", "chemotherapy") |
| limit | integer | No | Results per page (default 10, max 100) |
| query | string | No | Search term (e.g. "diabetes", "pembrolizumab", "Pfizer COVID vaccine") |
| status | string | No |
Filter by trial status
enum: RECRUITING, COMPLETED, ACTIVE_NOT_RECRUITING, NOT_YET_RECRUITING, TERMINATED, WITHDRAWN, SUSPENDED |
POST /api/v1/tools/clinical.study/call dynamic
Full details for a clinical trial by NCT ID — protocol, conditions, interventions with dosing, eligibility criteria (age, sex), primary/secondary outcomes, sponsor, enrollment, phase, study design, dates, results if available (ClinicalTrials.gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| nct_id | string | Yes | NCT identifier (e.g. "NCT03491410", "NCT04368728"). Get from search results |
POST /api/v1/tools/clinical.stats/call dynamic
Total number of registered clinical studies in the ClinicalTrials.gov database (577,000+ as of March 2026) (ClinicalTrials.gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No | Optional — currently returns total database statistics |
POST /api/v1/tools/namesilo.domain_check/call dynamic
Check if domain names are available for registration. Returns availability status, registration price, and renewal price per domain. Supports all TLDs (.com, .io, .dev, .app, .ai, etc.) (NameSilo)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domains | string | Yes | Comma-separated domain names to check availability (e.g. "example.com,mysite.io,startup.dev") |
POST /api/v1/tools/namesilo.domain_register/call dynamic
⚡ ACTION: Purchase and register a domain name (1-10 years). Includes free WHOIS privacy protection. Domain is registered instantly. Prices: .com ~$21, .org ~$12, .dev ~$18, .io ~$42 (NameSilo)
- Amount
- 21.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 21.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to register (e.g. "mybusiness.com") |
| private | boolean | No | Enable free WHOIS privacy (default true) |
| years | integer | No | Registration period in years (default 1, max 10) |
POST /api/v1/tools/namesilo.domain_list/call dynamic
List all domains registered in the account with expiry dates and status (NameSilo)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No | Optional keyword to filter domain list |
POST /api/v1/tools/namesilo.domain_info/call dynamic
Get detailed info for a domain — nameservers, creation/expiry dates, lock status, auto-renew setting, WHOIS contact (NameSilo)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to get details for (e.g. "example.com") |
POST /api/v1/tools/namesilo.get_prices/call dynamic
Get current registration, renewal, and transfer prices for popular TLDs (.com, .net, .org, .io, .dev, .app, .ai, .co, .xyz, .tech, etc.) (NameSilo)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| tld | string | No | Optional TLD to filter (e.g. "com", "io"). Omit for all popular TLDs |
POST /api/v1/tools/cloudflare.zones_list/call dynamic
List all domains (zones) managed in Cloudflare — zone ID, domain name, status (active/pending), plan, nameservers. Filter by domain name or status. Zone ID needed for all other Cloudflare tools (Cloudflare)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Results per page (default 20, max 50) |
| name | string | No | Filter by domain name (e.g. "example.com") |
| status | string | No |
Filter by zone status
enum: active, pending, initializing, moved, deleted |
POST /api/v1/tools/cloudflare.dns_list/call dynamic
List all DNS records for a Cloudflare zone — A, AAAA, CNAME, MX, TXT, NS records with name, content, TTL, proxy status. Filter by type or name (Cloudflare)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Results per page (default 50, max 100) |
| name | string | No | Filter by record name (e.g. "www.example.com") |
| type | string | No |
Filter by record type
enum: A, AAAA, CNAME, MX, TXT, NS, SRV, CAA |
| zone_id | string | Yes | Cloudflare Zone ID (from zones_list results) |
POST /api/v1/tools/cloudflare.dns_create/call dynamic
⚡ ACTION: Create a new DNS record (A, AAAA, CNAME, MX, TXT) for a Cloudflare zone. Set content (IP/hostname), TTL, and CDN proxy status. Returns new record ID (Cloudflare)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| content | string | Yes | Record value — IP address for A/AAAA, hostname for CNAME, text for TXT |
| name | string | Yes | Record name — subdomain or "@" for root (e.g. "www", "api", "@") |
| priority | integer | No | Priority for MX records (e.g. 10, 20) |
| proxied | boolean | No | Enable Cloudflare CDN proxy (default false). True = orange cloud, hides origin IP |
| ttl | integer | No | TTL in seconds (1 = automatic, 60-86400 for manual) |
| type | string | Yes |
DNS record type
enum: A, AAAA, CNAME, MX, TXT, NS, SRV, CAA |
| zone_id | string | Yes | Cloudflare Zone ID |
POST /api/v1/tools/cloudflare.dns_delete/call dynamic
⚡ ACTION: Delete a DNS record from a Cloudflare zone by record ID. Removes the record immediately (Cloudflare)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| record_id | string | Yes | DNS record ID to delete (from dns_list results) |
| zone_id | string | Yes | Cloudflare Zone ID |
POST /api/v1/tools/cloudflare.zone_analytics/call dynamic
Traffic analytics for a Cloudflare zone — total requests, cached vs uncached, bandwidth, threats blocked, page views. Supports custom time ranges (last 24h, 7 days, etc.) (Cloudflare)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| since | integer | No | Minutes ago to start from (e.g. -1440 for last 24h, -10080 for last 7 days) |
| zone_id | string | Yes | Cloudflare Zone ID |
POST /api/v1/tools/cloudflare.purge_cache/call dynamic
⚡ ACTION: Purge Cloudflare CDN cache — all cached files or specific URLs (max 30). Forces CDN to fetch fresh content from origin server (Cloudflare)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| files | array | No | Specific URLs to purge (max 30) |
| purge_everything | boolean | No | Purge all cached files (default false) |
| zone_id | string | Yes | Cloudflare Zone ID |
POST /api/v1/tools/vatcomply.validate/call dynamic
Validate a European VAT number via VIES — returns validity status, company name, and registered address. Supports all 27 EU member states + UK. Format: country prefix + number (e.g. DE123456789) (VATcomply, open source)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| vat_number | string | Yes | EU VAT number with country prefix (e.g. "DE123456789", "FR12345678901", "GB123456789") |
POST /api/v1/tools/vatcomply.rates/call dynamic
Get current VAT rates for EU countries — standard rate, reduced rates, super-reduced rate, parking rate. Query one country or all 27 EU members. Sourced from EU TEDB (VATcomply)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | No | ISO 3166-1 alpha-2 country code for specific country VAT rates (e.g. "DE", "FR", "IT"). Omit for all EU countries |
POST /api/v1/tools/vatcomply.currencies/call dynamic
Current ECB reference exchange rates for 30+ currencies (USD, GBP, JPY, CHF, etc.) plus currency metadata — symbol, decimal places, issuing countries (VATcomply / ECB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No | Optional currency code filter (e.g. "USD", "GBP"). Omit for all currencies |
POST /api/v1/tools/transcribe.submit/call dynamic
Submit an audio file URL for speech-to-text transcription. Returns a transcript_id to check status and retrieve results. Supports MP3, WAV, M4A, FLAC, OGG, WebM. 99 languages auto-detected. Optional speaker diarization (AssemblyAI)
- Amount
- 0.010000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.010000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| audio_url | string | Yes | Publicly accessible URL of the audio file to transcribe (MP3, WAV, M4A, FLAC, OGG, WebM) |
| language_code | string | No | Language code (e.g. "en", "es", "de", "fr", "ja"). Auto-detected if omitted |
| model | string | No |
Speech model: "universal-2" (default, fast, 99 languages) or "universal-3-pro" (highest accuracy, promptable)
enum: universal-2, universal-3-pro |
| speaker_labels | boolean | No | Enable speaker diarization — detect who said what (default false) |
POST /api/v1/tools/transcribe.status/call dynamic
Check the status of a transcription job by transcript_id — queued, processing, completed, or error. Returns audio duration when completed (AssemblyAI)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| transcript_id | string | Yes | Transcript ID returned from transcribe.submit (e.g. "aa8f42b3-e81e-453a-b010-a074ae76403b") |
POST /api/v1/tools/transcribe.result/call dynamic
Retrieve the completed transcription text, word count, confidence score, detected language, and speaker labels (if diarization was enabled). Use transcript_id from submit (AssemblyAI)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| transcript_id | string | Yes | Transcript ID to get the completed transcription text for |
POST /api/v1/tools/lei.search/call dynamic
Search 2.5M+ legal entities worldwide by name — companies, funds, government bodies across 200+ countries. Returns LEI code, name, country, city, status, entity category. Filter by country. CC0 open data (GLEIF)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | Filter by ISO 3166-1 alpha-2 country code (e.g. "US", "GB", "JP", "DE") |
| limit | integer | No | Max results (default 10, max 100) |
| name | string | Yes | Legal entity name to search (e.g. "Apple", "Goldman Sachs", "Toyota Motor") |
POST /api/v1/tools/lei.lookup/call dynamic
Full details for a legal entity by 20-character LEI code — legal name, registered address, headquarters, legal form, registration date, renewal date, status. Use LEI from search results (GLEIF)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lei | string | Yes | 20-character Legal Entity Identifier code (e.g. "HWUPKR0MPOU8FGXBT394" for Apple Inc) |
POST /api/v1/tools/lei.relationships/call dynamic
Find the direct parent company of a legal entity by LEI code — returns parent LEI, relationship type, and status. Useful for corporate ownership chain analysis (GLEIF)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lei | string | Yes | LEI code to find parent company relationship for |
POST /api/v1/tools/ukcompany.search/call dynamic
Search the UK Companies House registry by name — returns company number, name, type (plc/ltd), status (active/dissolved), incorporation date, registered address. Covers all companies registered under the Companies Act (Companies House UK Gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max results (default 10, max 100) |
| query | string | Yes | Company name to search (e.g. "Barclays", "Tesco", "ARM Holdings") |
POST /api/v1/tools/ukcompany.details/call dynamic
Full details for a UK company by Companies House number — company name, type, status, SIC codes, registered address, accounts due date, confirmation statement due, charges, insolvency history (Companies House UK Gov)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| company_number | string | Yes | UK Companies House number (e.g. "00048839" for Barclays, "00445790" for Tesco). Get from search results |
POST /api/v1/tools/edgar.company_search/call dynamic
Search US public companies and SEC filings by name, ticker, or keyword. Returns company name, CIK number, form type, filing date. Covers all companies registered with the US Securities and Exchange Commission (SEC EDGAR)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Max results to return (default 10, max 50) |
| query | string | Yes | Company name, ticker, or keyword to search (e.g. "Apple Inc", "TSLA", "artificial intelligence") |
POST /api/v1/tools/edgar.filings/call dynamic
List recent SEC filings for a company by CIK number — 10-K (annual), 10-Q (quarterly), 8-K (events), proxy statements. Returns form type, filing date, document URL, description. Up to 1000 filings per company (SEC EDGAR)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cik | string | Yes | SEC CIK number (e.g. "320193" for Apple, "789019" for Microsoft). Find via company_search |
POST /api/v1/tools/edgar.company_facts/call dynamic
XBRL financial facts for a US public company — revenue, net income, assets, liabilities, equity, EPS, cash, operating income. Returns last 5 reporting periods per metric with form type and date. Structured data from 10-K/10-Q filings (SEC EDGAR)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cik | string | Yes | SEC CIK number (e.g. "320193" for Apple). Returns XBRL financial facts: revenue, net income, assets, liabilities |
POST /api/v1/tools/edgar.xbrl_concept/call dynamic
Complete history of any XBRL financial concept (Revenues, NetIncomeLoss, Assets, EPS) for a company across all SEC filings. Returns up to 20 most recent values with period dates, form type, fiscal year. Free alternative to Bloomberg for historical financials.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cik | string | Yes | SEC CIK number (e.g. "320193" for Apple, "789019" for Microsoft) |
| tag | string | Yes | XBRL concept tag (e.g. Revenues, NetIncomeLoss, Assets, EarningsPerShareBasic) |
| taxonomy | string | No | XBRL taxonomy (default: us-gaap). Other: ifrs-full, dei, srt |
POST /api/v1/tools/edgar.xbrl_frames/call dynamic
Compare a financial metric across ALL SEC-reporting companies for a period. Query Revenues for CY2023 → 2,649 companies with values. Top: Walmart $648B, UnitedHealth $371B. Free alternative to Bloomberg/FactSet. Period format: CY2023 (annual), CY2023Q4I (quarterly).
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| period | string | Yes | Reporting period: CY2023 (annual), CY2023Q4I (quarterly instant), CY2023Q3 (quarterly duration) |
| tag | string | Yes | XBRL concept tag (e.g. Revenues, NetIncomeLoss, Assets, TotalDebt) |
| taxonomy | string | No | XBRL taxonomy (default: us-gaap) |
| unit | string | No | Unit of measure (default: USD). Other: USD/shares for EPS, shares for share counts |
POST /api/v1/tools/bluesky.search_posts/call dynamic
Search posts across the Bluesky decentralized social network by keyword. Returns post text, author handle, display name, like/repost/reply counts, timestamps. Sort by relevance or latest. Filter by language (AT Protocol / Bluesky)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lang | string | No | Filter by language code (e.g. "en", "ja", "pt") |
| limit | integer | No | Max results (default 25, max 100) |
| q | string | Yes | Search query for Bluesky posts (e.g. "MCP server", "AI agents", "Claude") |
| sort | string | No |
Sort order: "top" (relevance) or "latest" (chronological)
enum: top, latest |
POST /api/v1/tools/bluesky.profile/call dynamic
Get a Bluesky user profile — display name, bio, avatar URL, follower/following/post counts, account creation date. Lookup by handle (e.g. "jay.bsky.team") (AT Protocol / Bluesky)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| handle | string | Yes | Bluesky handle (e.g. "jay.bsky.team", "pfrazee.com", "apibase.bsky.social") |
POST /api/v1/tools/bluesky.feed/call dynamic
Get recent posts from a Bluesky user by handle — post text, timestamps, like/repost counts. Up to 100 posts per request (AT Protocol / Bluesky)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| handle | string | Yes | Bluesky handle to get posts from (e.g. "jay.bsky.team") |
| limit | integer | No | Number of posts to return (default 20, max 100) |
POST /api/v1/tools/artic.search/call dynamic
Search 120,000+ artworks at the Art Institute of Chicago — paintings, sculptures, photographs, prints, textiles. Returns title, artist, date, medium, dimensions, IIIF image URL, public domain status. Covers all periods and regions (ARTIC)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (default 10, max 100) |
| page | integer | No | Page number for pagination (default 1) |
| q | string | Yes | Search query for artworks (e.g. "monet water lilies", "picasso", "impressionism", "Japanese woodblock") |
POST /api/v1/tools/artic.artwork/call dynamic
Full details for a single artwork — title, artist, date, medium, dimensions, credit line, place of origin, department, provenance, exhibition history, high-res IIIF image URL. Use artwork ID from search results (ARTIC)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | ARTIC artwork ID from search results (e.g. 16568 for Monet Water Lilies) |
POST /api/v1/tools/artic.artist/call dynamic
Search artists and makers in the Art Institute of Chicago collection — name, birth/death dates, biography. Find artist IDs for cross-referencing with artwork search (ARTIC)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (default 10, max 100) |
| q | string | Yes | Artist name to search (e.g. "Claude Monet", "Picasso", "Georgia O'Keeffe") |
POST /api/v1/tools/europeana.search/call dynamic
Search 50M+ cultural heritage objects across 4,000 institutions in 36 European countries — paintings, photographs, books, maps, 3D objects, music, film. Multilingual (24 languages). Filter by country, media type. Returns title, creator, thumbnail, provider, year (Europeana)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | Filter by country (e.g. "Netherlands", "France", "Italy", "Germany") |
| media | boolean | No | Only return items with media (images/video/audio) — default false |
| query | string | Yes | Search term (e.g. "Rembrandt", "Mona Lisa", "medieval manuscript", "Art Nouveau poster") |
| rows | integer | No | Number of results to return (default 12, max 100) |
| start | integer | No | Start position for pagination (default 1) |
POST /api/v1/tools/europeana.record/call dynamic
Full metadata for a single cultural heritage object — title, creator, description, date, language, source, rights, high-res image URL, provider institution, landing page. Use ID from search results (Europeana)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | string | Yes | Europeana record ID from search results (e.g. "/09102/_GNM_693983" or "09102/_GNM_693983") |
POST /api/v1/tools/convert.to_pdf/call dynamic
Convert Word (DOCX), Excel (XLSX), PowerPoint (PPTX), HTML, Markdown, RTF, ODT, or images (JPG/PNG/SVG) to PDF. Provide source file as URL. Custom page size and orientation. 200+ format pairs supported (ConvertAPI)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| from_format | string | Yes |
Source file format
enum: docx, xlsx, pptx, html, md, jpg, png, svg, rtf, odt, txt |
| orientation | string | No |
Page orientation (default "portrait")
enum: portrait, landscape |
| page_size | string | No |
PDF page size (default "a4")
enum: a4, letter, legal, a3, a5 |
| source_url | string | Yes | Publicly accessible URL of the source file to convert (e.g. "https://example.com/report.docx") |
POST /api/v1/tools/convert.from_pdf/call dynamic
Convert PDF to Word (DOCX), Excel (XLSX), PowerPoint (PPTX), plain text (TXT), or images (JPG/PNG per page). Optional page range selection. Provide PDF as URL (ConvertAPI)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| pages | string | No | Page range to convert (e.g. "1-5", "1,3,5", default "all") |
| source_url | string | Yes | Publicly accessible URL of the PDF to convert (e.g. "https://example.com/doc.pdf") |
| to_format | string | Yes |
Target format to convert PDF into
enum: docx, xlsx, pptx, txt, jpg, png |
POST /api/v1/tools/convert.web_to_pdf/call dynamic
Render any web page URL to PDF with full JavaScript execution — custom viewport width, lazy content loading, wait delay. Returns PDF download URL (ConvertAPI)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| delay | integer | No | Seconds to wait after page load before capturing (default 0) |
| load_lazy_content | boolean | No | Scroll page to trigger lazy-loaded images (default false) |
| url | string | Yes | Web page URL to render as PDF (e.g. "https://example.com") |
| viewport_width | integer | No | Browser viewport width in pixels (default 1280) |
POST /api/v1/tools/pdf.from_html/call dynamic
Convert HTML content to a PDF document using headless Chrome — full CSS + JavaScript rendering, custom page size, margins, headers/footers, background colors. Returns a temporary download URL for the generated PDF (API2PDF)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fileName | string | No | Output filename (e.g. "report.pdf") |
| html | string | Yes | HTML content to convert to PDF (full document or fragment, e.g. "<h1>Report</h1><p>Content here</p>") |
| options | object | No | PDF rendering options (page size, margins, header/footer) |
POST /api/v1/tools/pdf.from_url/call dynamic
Capture any web page URL as a PDF using headless Chrome with full JS rendering — perfect for archiving pages, generating reports from dashboards, or creating printable snapshots. Returns temporary PDF download URL (API2PDF)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fileName | string | No | Output filename (e.g. "snapshot.pdf") |
| options | object | No | PDF rendering options |
| url | string | Yes | URL to capture as PDF (e.g. "https://example.com/report") |
POST /api/v1/tools/pdf.merge/call dynamic
Merge 2-20 PDF documents (provided as URLs) into a single combined PDF. Preserves page order. Returns temporary download URL for the merged result (API2PDF)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| fileName | string | No | Output filename for merged PDF (e.g. "combined.pdf") |
| urls | array | Yes | Ordered list of PDF URLs to merge (2-20 URLs) |
POST /api/v1/tools/podcast.search/call dynamic
Search 4M+ podcasts by keyword — returns title, author, description, artwork, episode count, language, categories, RSS feed URL. Open directory covering all languages and countries (PodcastIndex)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cat | string | No | Filter by category name (e.g. "Technology", "News", "Comedy", "Business") |
| lang | string | No | Filter by language code (e.g. "en", "de", "es", "ja") |
| max | integer | No | Max results to return (default 20, max 100) |
| q | string | Yes | Search term or phrase (e.g. "artificial intelligence", "Lex Fridman", "true crime") |
POST /api/v1/tools/podcast.trending/call dynamic
Currently trending podcasts globally — ranked by recent episode engagement. Filter by language and category. Returns title, author, artwork, trending score, episode count (PodcastIndex)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cat | string | No | Filter by category (e.g. "Technology", "News") |
| lang | string | No | Filter by language code (e.g. "en") |
| max | integer | No | Number of trending podcasts (default 20, max 100) |
| since | integer | No | Unix timestamp — only include podcasts with new episodes since this time |
POST /api/v1/tools/podcast.episodes/call dynamic
List recent episodes for a podcast by feed ID — title, description, publish date, audio URL, duration, season/episode numbers. Use feed ID from search or trending results (PodcastIndex)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | PodcastIndex feed ID (from search or trending results) |
| max | integer | No | Number of episodes to return (default 20, max 100) |
| since | integer | No | Unix timestamp — only return episodes published after this time |
POST /api/v1/tools/podcast.by_feed/call dynamic
Full metadata for a single podcast — title, author, description, RSS URL, artwork, language, categories, episode count, last update time, funding links (PodcastIndex)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | PodcastIndex feed ID to retrieve full metadata for |
POST /api/v1/tools/geocodio.geocode/call dynamic
Forward geocode a US or Canada address to coordinates — returns lat/lng, parsed address components (street, city, state, ZIP, county), accuracy type (rooftop/range/street), and data source. USPS-standardized results with Census data (Geocodio)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| address | string | Yes | US or Canada address to geocode (e.g. "1600 Pennsylvania Ave NW, Washington DC", "350 5th Ave, New York, NY 10118") |
| limit | integer | No | Max results to return (default 5, max 20) |
POST /api/v1/tools/geocodio.reverse/call dynamic
Reverse geocode latitude/longitude to a US or Canada address — returns formatted address, parsed components (street, city, state, ZIP, county), accuracy type, and source. Supports multiple results ranked by proximity (Geocodio)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lat | number | Yes | Latitude (24-72 range for US/Canada, e.g. 38.8976) |
| limit | integer | No | Max results to return (default 5, max 20) |
| lon | number | Yes | Longitude (negative for Western Hemisphere, e.g. -77.0365) |
POST /api/v1/tools/hunter.company/call dynamic
Find professional email addresses and company data for any domain — organization name, industry, employee count, tech stack, social profiles, email pattern, and verified contact emails with confidence scores, positions, departments, seniority levels. 50M+ domains indexed (Hunter.io)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| department | string | No |
Filter by department (e.g. "engineering", "sales", "marketing")
enum: executive, finance, hr, it, marketing, operations, sales, legal, management, communication |
| domain | string | Yes | Company domain name (e.g. "stripe.com", "google.com", "microsoft.com") |
| limit | integer | No | Max number of emails to return (default 10, max 100) |
| type | string | No |
Filter by email type: "personal" (name@domain) or "generic" (info@domain)
enum: personal, generic |
POST /api/v1/tools/fdic.search/call dynamic
Search 4,300+ FDIC-insured US financial institutions by name, city, state, or charter type. Returns bank name, FDIC certificate number, total assets, deposits, and location. Official US Government data.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| active | boolean | No | Filter by active status. Default true (only active institutions) |
| charter_class | string | No |
Charter type: N=national, SM=state member, NM=state nonmember, SB=savings bank, OI=OCC-supervised
enum: N, SM, NM, SB, OI |
| city | string | No | City name filter (e.g. "New York", "San Francisco") |
| limit | integer | No | Number of results to return, max 50 (default 10) |
| name | string | No | Partial or full institution name to search (e.g. "Chase", "Wells Fargo") |
| state | string | No | US state name filter (e.g. "California", "New York") |
POST /api/v1/tools/fdic.details/call dynamic
Get full regulatory profile for an FDIC-insured bank by certificate number. Returns address, charter class, regulator, assets, deposits, branches, established date, insurance date, and coordinates.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cert | integer | Yes | FDIC certificate number uniquely identifying the institution (obtain via fdic.search) |
POST /api/v1/tools/fdic.financials/call dynamic
Retrieve quarterly Call Report financial data for an FDIC-insured institution. Returns total assets, deposits, equity, net income, ROA, ROE, net interest margin, and efficiency ratio.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cert | integer | Yes | FDIC certificate number for the institution |
| limit | integer | No | Number of quarterly periods to return, max 20 (default 4) |
POST /api/v1/tools/fdic.failures/call dynamic
Query the FDIC failed bank list. Returns 4,100+ historical bank failures with failure date, assets at closure, acquiring institution, and estimated loss to the Deposit Insurance Fund. Covers all failures since 1934.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results to return, max 50 (default 10) |
| state | string | No | Two-letter US state code filter (e.g. "CA", "NY", "TX") |
POST /api/v1/tools/disease.covid_global/call dynamic
Get aggregated global COVID-19 statistics: total cases (704M+), deaths, recoveries, active cases, critical cases, cases/deaths per million, tests administered, and affected countries count. Data from Worldometers and OWID.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| twoDaysAgo | boolean | No | Return data from two days ago for comparison (default false) |
| yesterday | boolean | No | Return yesterday's data instead of today's (default false) |
POST /api/v1/tools/disease.covid_country/call dynamic
Get COVID-19 statistics for a specific country by name or ISO code. Returns cases, deaths, recoveries, active, critical, per-million rates, tests, population, and flag. Covers 215+ countries and territories.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | Yes | Country name, ISO2 code, or ISO3 code (e.g. "United States", "US", "USA", "Germany", "DE") |
| strict | boolean | No | Use strict name matching instead of fuzzy search (default false) |
| yesterday | boolean | No | Return yesterday's data instead of today's (default false) |
POST /api/v1/tools/disease.covid_history/call dynamic
Get historical time-series COVID-19 data for a country or globally. Returns daily case, death, and recovery counts. Useful for trend analysis and longitudinal research. Data from Johns Hopkins CSSE.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | Country name, ISO2/ISO3 code, or "all" for global aggregate (default "all") |
| lastdays | integer | No | Number of most recent days to return (default 30, max ~1500 for full history) |
POST /api/v1/tools/disease.influenza/call dynamic
Get US influenza surveillance data from CDC FluView. Returns weekly ILI (influenza-like illness) activity levels by age group, positive test rates by influenza type (A/B), and national summary. Updated weekly.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| source | string | No |
Data source: "ilinet" for ILI network data or "usil" for US ILI summary (default "ilinet")
enum: ilinet, usil |
POST /api/v1/tools/who.indicators/call dynamic
List 1,000+ WHO Global Health Observatory indicators: life expectancy, mortality rates, disease burden, immunization, nutrition, mental health, environmental health. Returns indicator codes for use with who.data.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of indicators to return, max 100 (default 20) |
| search | string | No | Keyword to filter indicators by name (e.g. "mortality", "immunization", "life expectancy", "HIV", "malaria") |
POST /api/v1/tools/who.data/call dynamic
Retrieve WHO health data for a specific indicator, optionally filtered by country and year range. Returns values for up to 194 countries spanning multiple decades. Official UN member state reporting data.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO 3166-1 alpha-3 country code (e.g. "USA", "DEU", "BRA", "JPN"). Omit for all countries |
| indicator | string | Yes | WHO indicator code (e.g. "WHOSIS_000001" for life expectancy, "MDG_0000000001" for under-5 mortality). Get codes from who.indicators |
| limit | integer | No | Number of data points to return, max 100 (default 20) |
| year_from | integer | No | Earliest year to include (e.g. 2000) |
| year_to | integer | No | Latest year to include (e.g. 2023) |
POST /api/v1/tools/who.countries/call dynamic
List all 194 WHO member countries and territories with codes and names. Use returned country codes with who.data to filter health indicators by country.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of countries to return, max 200 (default 50) |
| search | string | No | Partial country name to filter (e.g. "United", "Germany", "Brazil") |
POST /api/v1/tools/gdacs.alerts/call dynamic
Get current and recent global disaster alerts from the UN GDACS system. Returns earthquakes, tropical cyclones, floods, volcanoes, droughts, and tsunamis with color-coded severity (Green/Orange/Red), affected country, coordinates, and population impact estimates.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| alert_level | string | No |
Minimum alert level filter: Green (low), Orange (medium), Red (high impact)
enum: Green, Orange, Red |
| event_type | string | No |
Filter by disaster type: EQ=earthquake, TC=tropical cyclone, FL=flood, VO=volcano, DR=drought, TS=tsunami
enum: EQ, TC, FL, VO, DR, TS |
| limit | integer | No | Number of events to return, max 50 (default 10) |
POST /api/v1/tools/gdacs.events/call dynamic
Get detailed information for a specific GDACS disaster event by ID. Returns event name, alert level with justification, affected population at each severity level, coordinates, geometry for mapping, source agency, and situation report links.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| event_id | integer | Yes | GDACS event ID (obtain via gdacs.alerts) |
| event_type | string | Yes |
Event type code: EQ=earthquake, TC=tropical cyclone, FL=flood, VO=volcano, DR=drought, TS=tsunami
enum: EQ, TC, FL, VO, DR, TS |
POST /api/v1/tools/gdacs.history/call dynamic
Query the GDACS historical disaster archive from 2000 onwards. Filter by date range, event type, country, and alert level. Returns past earthquakes, cyclones, floods, and volcanoes for disaster frequency analysis and regional risk assessment.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| alert_level | string | No |
Minimum alert level filter
enum: Green, Orange, Red |
| country | string | No | ISO 3166-1 alpha-3 country code (e.g. "JPN", "PHL", "USA", "IDN") |
| date_from | string | Yes | Start date in YYYY-MM-DD format (e.g. "2024-01-01") |
| date_to | string | Yes | End date in YYYY-MM-DD format (e.g. "2024-12-31") |
| event_type | string | No |
Filter by disaster type
enum: EQ, TC, FL, VO, DR, TS |
| limit | integer | No | Number of events to return, max 50 (default 10) |
POST /api/v1/tools/rateapi.mortgage/call dynamic
Get AI-powered mortgage rate decision from 4,300+ US lenders. Returns recommended actions, current APR rates, estimated monthly payments, and confidence scores. Supports 30yr/15yr fixed and ARM products. Filter by state, amount, and credit tier.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| amount | number | No | Loan amount in USD (e.g. 400000 for a $400K mortgage) |
| credit_score | string | No |
Credit score tier for rate filtering
enum: excellent, good, fair, poor |
| intent | string | No |
Loan intent: "purchase" for buying or "refinance"
enum: purchase, refinance |
| rate_type | string | No |
Rate type: "fixed" or "adjustable" (ARM)
enum: fixed, adjustable |
| state | string | No | Two-letter US state code (e.g. "CA", "NY", "TX") |
| term_months | integer | No | Loan term in months: 180 (15yr), 360 (30yr), or custom |
POST /api/v1/tools/rateapi.auto_loan/call dynamic
Get auto loan rate decision for new and used vehicles from US lenders. Returns recommended financing actions, APR rates by term (24-72 months), and estimated monthly payments. Filter by vehicle type and credit tier.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| amount | number | No | Loan amount in USD (e.g. 35000) |
| credit_score | string | No |
Credit score tier
enum: excellent, good, fair, poor |
| state | string | No | Two-letter US state code |
| term_months | string | No |
Loan term: 24, 36, 48, 60, or 72 months
enum: 24, 36, 48, 60, 72 |
| vehicle_type | string | No |
Vehicle type: "new" or "used"
enum: new, used |
POST /api/v1/tools/rateapi.heloc/call dynamic
Get Home Equity Line of Credit (HELOC) rate decision. Returns current HELOC APR rates, recommended actions, and lender comparisons. Filter by combined loan-to-value ratio (CLTV), state, and credit score tier.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cltv | number | No | Combined loan-to-value ratio (0-95) |
| credit_score | string | No |
Credit score tier
enum: excellent, good, fair, poor |
| state | string | No | Two-letter US state code |
POST /api/v1/tools/rateapi.personal_loan/call dynamic
Get personal loan rate decision from US lenders. Returns recommended financing actions, APR rates by term and amount, and monthly payment estimates. Filter by loan amount, term, and credit score tier.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| amount | number | No | Loan amount in USD (e.g. 10000) |
| credit_score | string | No |
Credit score tier
enum: excellent, good, fair, poor |
| term_months | string | No |
Loan term: 12, 24, 36, 48, or 60 months
enum: 12, 24, 36, 48, 60 |
POST /api/v1/tools/twitter.search/call dynamic
Search Twitter/X tweets by keyword, hashtag, or advanced query. Returns tweet text, author info, engagement metrics (likes, retweets, replies, views), and timestamps. 96% cheaper than official X API. Covers recent tweets.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cursor | string | No | Pagination cursor from previous response (for next page of results) |
| query | string | Yes | Search query — keywords, hashtags, or advanced operators (e.g. "AI agents", "#crypto", "from:elonmusk") |
| sort_order | string | No |
Sort order: "recency" for latest first, "relevancy" for most relevant (default recency)
enum: recency, relevancy |
POST /api/v1/tools/twitter.user/call dynamic
Get a Twitter/X user profile by username. Returns display name, bio, follower/following count, tweet count, verified status, profile image, location, and account creation date.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| user_id | string | No | Twitter/X numeric user ID as alternative to username |
| username | string | No | Twitter/X username without @ (e.g. "elonmusk", "OpenAI") |
POST /api/v1/tools/twitter.followers/call dynamic
Get paginated follower list for a Twitter/X user. Returns follower profiles with username, display name, bio, follower count, and verified status. Supports cursor pagination.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cursor | string | No | Pagination cursor from previous response |
| username | string | Yes | Twitter/X username to get followers for (without @) |
POST /api/v1/tools/twitter.trending/call dynamic
Get current trending topics on Twitter/X. Filter by location using WOEID (Where On Earth ID). Returns trend name, search query, and rank. 1=worldwide, 23424977=US, 23424975=UK.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| woeid | integer | No | Where On Earth ID for location-specific trends (1=worldwide, 23424977=US, 23424975=UK, 23424856=Japan) |
POST /api/v1/tools/currents.latest/call dynamic
Get latest breaking news from 70+ countries in 18+ languages. Returns full article text, author, source URL, and publication time. Filter by language, country, and category (technology, business, health, sports, science, finance, world).
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No | News category filter (e.g. "technology", "business", "health", "sports", "science", "entertainment", "finance", "world") |
| country | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "GB", "DE", "JP") |
| language | string | No | ISO 639-1 language code (e.g. "en", "de", "fr", "ja", "zh"). Default: all languages |
| page_size | integer | No | Number of articles to return, max 200 (default 10) |
POST /api/v1/tools/currents.search/call dynamic
Search news articles by keyword across 70+ countries and 18+ languages. Returns full article text with Boolean operator support. Filter by language, country, category, and date range.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO 3166-1 alpha-2 country code |
| end_date | string | No | End date in ISO 8601 format |
| keywords | string | Yes | Search keywords — supports Boolean operators (e.g. "AI agents", "climate AND policy") |
| language | string | No | ISO 639-1 language code (e.g. "en", "es", "ar") |
| page_size | integer | No | Number of articles to return, max 200 (default 10) |
| start_date | string | No | Start date in ISO 8601 format (e.g. "2026-03-01T00:00:00+00:00") |
POST /api/v1/tools/currents.categories/call dynamic
List all 46 available news categories: technology, business, health, sports, science, entertainment, finance, world, politics, and more. Use to discover valid category values for filtering.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| locale | string | No | Response locale (default: en) |
POST /api/v1/tools/iban.validate/call dynamic
Validate an IBAN and retrieve associated bank info: BIC/SWIFT code, bank name, address, country, currency, and SEPA membership. Supports 80+ IBAN-enabled countries including EU, UK, and MENA. Returns validation result with detailed breakdown.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| iban | string | Yes | IBAN to validate (e.g. "DE89370400440532013000", "GB29NWBK60161331926819"). Spaces allowed, auto-stripped. |
POST /api/v1/tools/iban.calculate/call dynamic
Calculate a valid IBAN from domestic bank routing details: country code, bank code, account number, and optional branch code. Returns the computed IBAN with correct checksum. Useful for payment automation.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| account_number | string | Yes | Account number in domestic format |
| bank_code | string | Yes | Domestic bank code (e.g. "37040044" for Germany, "NWBK" for UK) |
| branch_code | string | No | Branch/sort code if required by the country (e.g. "601613" for UK) |
| country_code | string | Yes | ISO 3166-1 alpha-2 country code (e.g. "DE", "GB", "FR", "NL") |
POST /api/v1/tools/pubchem.compound_search/call dynamic
Search 100M+ chemical compounds by name, formula, or SMILES string. Returns CID, molecular formula, weight, IUPAC name, SMILES, InChI, XLogP, H-bond donors/acceptors, exact mass, and complexity. The largest public chemical database (PubChem / NCBI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Maximum results to return (1-20, default 5) |
| name | string | Yes | Compound name, formula, or SMILES string (e.g. "aspirin", "C9H8O4", "CC(=O)OC1=CC=CC=C1C(=O)O") |
POST /api/v1/tools/pubchem.compound_properties/call dynamic
Get full physical and chemical properties for a compound by PubChem CID — molecular formula, weight, SMILES, InChI, InChIKey, XLogP, H-bond donors/acceptors, exact mass, topological polar surface area, complexity, charge, heavy atom count (PubChem / NCBI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cid | integer | Yes | PubChem Compound ID (CID) — get from compound_search results |
POST /api/v1/tools/pubchem.compound_synonyms/call dynamic
Get all known names, CAS registry numbers, trade names, and identifiers for a chemical compound by PubChem CID. Returns up to 50 synonyms from a database of millions of name variants (PubChem / NCBI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cid | integer | Yes | PubChem Compound ID (CID) — returns all known names, CAS numbers, trade names |
POST /api/v1/tools/pubchem.hazard_data/call dynamic
Get GHS (Globally Harmonized System) hazard classification for a compound — signal words (Danger/Warning), hazard statements (H-codes), precautionary statements (P-codes), pictograms. Essential for chemical safety assessments (PubChem / NCBI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cid | integer | Yes | PubChem Compound ID (CID) — returns GHS hazard classification, pictograms, signal words |
POST /api/v1/tools/pubchem.bioassay_summary/call dynamic
Get bioactivity assay results for a compound — active/inactive counts, tested targets, assay types. Shows how the compound performed in biological tests across thousands of assays (PubChem / NCBI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cid | integer | Yes | PubChem Compound ID (CID) — returns bioactivity assay results (active/inactive counts, targets) |
POST /api/v1/tools/pubchem.structure_lookup/call dynamic
Look up a compound by name or identifier and get its chemical structure representations — SMILES (isomeric + canonical), InChI, InChIKey, molecular formula, and molecular weight. Convert between chemical identifier formats (PubChem / NCBI)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| name | string | Yes | Compound name or identifier (e.g. "caffeine", "50-78-2") — returns SMILES, InChI, InChIKey, formula |
POST /api/v1/tools/evcharge.search/call dynamic
Search 300K+ EV charging stations worldwide by location, country, operator, connector type, and power level. Returns station address, GPS coordinates, connectors (Type 2, CCS, CHAdeMO), power kW, operator, status. Filter by min power for fast charging. Largest open EV charging database (Open Charge Map)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| connection_type_id | integer | No | Filter by connector type (e.g. 25=Type 2, 33=CCS, 2=CHAdeMO) |
| country_code | string | No | ISO 2-letter country code to filter by (e.g. "US", "GB", "DE") |
| distance | number | No | Search radius in distance_unit (default KM) |
| distance_unit | string | No |
Distance unit: KM or Miles (default KM)
enum: KM, Miles |
| latitude | number | No | Latitude for location-based search (e.g. 51.5074) |
| limit | integer | No | Maximum results to return (1-100, default 20) |
| longitude | number | No | Longitude for location-based search (e.g. -0.1278) |
| min_power_kw | number | No | Minimum charger power in kW (e.g. 50 for fast charging) |
| operator_id | integer | No | Filter by charging network operator ID |
| status_type_id | integer | No | Filter by status (50=Operational, 100=Not Operational) |
POST /api/v1/tools/evcharge.details/call dynamic
Get full details for a specific EV charging station by ID — address, GPS coordinates, all connectors with type/power/status, network operator, usage cost, verification date, number of charging points. Use station ID from search or nearby results (Open Charge Map)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | Open Charge Map station ID — get from search or nearby results |
POST /api/v1/tools/evcharge.nearby/call dynamic
Find the nearest EV charging stations to GPS coordinates within a radius (default 5km). Returns stations sorted by distance with connector types, power levels, and availability status. Filter by minimum power kW and connector type for DC fast charging (Open Charge Map)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| connection_type_id | integer | No | Filter by connector type (25=Type 2, 33=CCS, 2=CHAdeMO) |
| latitude | number | Yes | GPS latitude of your location (e.g. 40.7128) |
| limit | integer | No | Maximum results (1-50, default 10) |
| longitude | number | Yes | GPS longitude of your location (e.g. -74.0060) |
| min_power_kw | number | No | Minimum charger power in kW (e.g. 50 for DC fast charging) |
| radius | number | No | Search radius in KM (default 5) |
POST /api/v1/tools/ipqs.ip_check/call dynamic
Check any IP address for fraud signals — proxy, VPN, Tor, bot, crawler detection with fraud score (0-100). Returns geolocation (country, city, ISP, ASN), abuse velocity, connection type, and 9+ risk indicators. Essential for e-commerce fraud prevention (IPQualityScore)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| allow_public_access_points | boolean | No | Allow public WiFi/library IPs to pass without penalty (default false) |
| ip | string | Yes | IPv4 or IPv6 address to check (e.g. "8.8.8.8", "2001:4860:4860::8888") |
| strictness | integer | No | Detection strictness 0-3 (0=least strict, 3=most aggressive). Higher catches more fraud but may flag legitimate users |
POST /api/v1/tools/ipqs.email_check/call dynamic
Validate email for fraud risk — checks deliverability, disposable/temporary providers, honeypot traps, spam traps, leaked credentials, catch-all detection. Returns fraud score (0-100), SMTP verification, domain age, and abuse history. Goes beyond basic validation (IPQualityScore)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| abuse_strictness | integer | No | Abuse detection sensitivity 0-2 (0=low, 2=aggressive) |
| string | Yes | Email address to validate and check for fraud (e.g. "[email protected]") | |
| fast | boolean | No | Skip SMTP verification for faster response (default false) |
POST /api/v1/tools/ipqs.url_check/call dynamic
Scan any URL for malware, phishing, suspicious content, adult content, spamming, and domain parking. Returns risk score (0-100), domain reputation, domain age, IP address, HTTP status. Protects agents from visiting malicious URLs (IPQualityScore)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| strictness | integer | No | Scanning strictness 0-2 (0=least strict, 2=most aggressive) |
| url | string | Yes | Full URL to scan for malware, phishing, and threats (e.g. "https://example.com/page") |
POST /api/v1/tools/ipqs.phone_check/call dynamic
Check phone number for fraud risk — detects VOIP, prepaid, risky numbers, carrier info, line type (mobile/landline/VOIP), active status, leaked data. Returns fraud score (0-100) and geographic location. Supports international numbers with country filter (IPQualityScore)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO 2-letter country code for national format numbers (e.g. "US", "GB") |
| phone | string | Yes | Phone number to check in E.164 or national format (e.g. "+12125551234", "2125551234") |
| strictness | integer | No | Fraud detection strictness 0-2 |
POST /api/v1/tools/chem.resolve/call dynamic
Convert any chemical identifier to SMILES, InChI, and InChIKey. Input a compound name (e.g. "aspirin"), CAS number (e.g. "50-78-2"), SMILES, or InChIKey and get all other representations. The only universal chemical ID converter — essential for chemistry workflows and cross-database lookups (NCI CACTUS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| identifier | string | Yes | Chemical identifier to resolve — compound name (e.g. "aspirin", "caffeine"), CAS number (e.g. "50-78-2"), SMILES (e.g. "CC(=O)Oc1ccccc1C(O)=O"), or InChIKey (e.g. "BSYNRYMUTXBXSQ-UHFFFAOYSA-N") |
| output | string | No |
Output format: "all" (SMILES + InChI + InChIKey), "smiles" (canonical SMILES only), "stdinchi" (Standard InChI only), "stdinchikey" (InChIKey only). Default: "all"
enum: all, smiles, stdinchi, stdinchikey default: all
|
POST /api/v1/tools/chem.formula/call dynamic
Get molecular formula and molecular weight for any compound by name, CAS number, or SMILES. Returns formula (e.g. "C9H8O4" for aspirin) and weight in daltons (e.g. 180.157). Accepts any chemical identifier format (NCI CACTUS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| identifier | string | Yes | Chemical identifier — compound name (e.g. "ibuprofen"), CAS number (e.g. "15687-27-1"), or SMILES string. Returns molecular formula and weight |
POST /api/v1/tools/chem.names/call dynamic
Get all known names, synonyms, CAS numbers, and registry IDs for a chemical compound. Input any identifier (name, CAS, SMILES, InChIKey) and get the full list of aliases. Useful for finding alternative names, trade names, and cross-references (NCI CACTUS)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| identifier | string | Yes | Chemical identifier to look up synonyms for — compound name, CAS number, SMILES, or InChIKey (e.g. "aspirin", "50-78-2") |
| limit | integer | No |
Maximum number of names/synonyms to return (1-100). Default: 20
default: 20
|
POST /api/v1/tools/safety.recalls/call dynamic
Search NHTSA vehicle recalls by make, model, and year. Returns campaign number, manufacturer, subject, summary, consequence, remedy, affected components, and units affected. Covers all US recalls from 1966 to present. Essential for automotive safety, insurance, and fleet management agents (NHTSA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| make | string | Yes | Vehicle manufacturer name (e.g. "Toyota", "Ford", "Tesla", "BMW") |
| model | string | Yes | Vehicle model name (e.g. "Camry", "Model 3", "F-150", "X5") |
| model_year | integer | Yes | Model year (e.g. 2023). NHTSA recall data available from 1966 to present |
POST /api/v1/tools/safety.complaints/call dynamic
Search consumer complaints filed with NHTSA about vehicles. Returns incident details including crash/fire flags, injuries, deaths, affected components, and complaint summary. Covers US vehicles from ~1995 to present. Critical for safety research and product liability analysis (NHTSA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| make | string | Yes | Vehicle manufacturer name (e.g. "Toyota", "Ford", "Tesla", "Honda") |
| model | string | Yes | Vehicle model name (e.g. "Camry", "Model 3", "Civic") |
| model_year | integer | Yes | Model year (e.g. 2023). NHTSA complaint data available from ~1995 to present |
POST /api/v1/tools/safety.ratings/call dynamic
Get NCAP 5-Star crash test safety ratings by make/model/year or vehicle ID. Returns overall rating, frontal crash, side crash, and rollover ratings (1-5 stars). Also shows related complaints, recalls, and investigation counts. Available from ~2011 for US-market vehicles (NHTSA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| make | string | No | Vehicle manufacturer name (e.g. "Toyota", "Honda"). Required unless vehicle_id is provided |
| model | string | No | Vehicle model name (e.g. "Camry", "Civic"). Required unless vehicle_id is provided |
| model_year | integer | No | Model year (e.g. 2023). 5-Star ratings available from ~2011. Required unless vehicle_id is provided |
| vehicle_id | integer | No | NHTSA Vehicle ID for full ratings detail (get from initial search). Overrides make/model/year if provided |
POST /api/v1/tools/safety.investigations/call dynamic
Search NHTSA defect investigation records by manufacturer and model. Returns investigation number, type (preliminary/engineering analysis), description, latest activity date, and NHTSA action number. Covers active and closed investigations for US vehicles (NHTSA)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| make | string | Yes | Vehicle manufacturer name (e.g. "Tesla", "GM", "Ford") |
| model | string | No | Vehicle model name to narrow results (e.g. "Model 3", "Bolt EV") |
POST /api/v1/tools/pdb.search/call dynamic
Search 220K+ macromolecular 3D structures in the Protein Data Bank by keyword, protein name, organism, or author. Returns PDB IDs with relevance scores. The canonical database for structural biology, X-ray crystallography, cryo-EM, and NMR structures (RCSB PDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No |
Maximum number of results (1-50). Default: 10
default: 10
|
| query | string | Yes | Search query — keyword, protein name, organism, or author (e.g. "insulin", "hemoglobin", "Homo sapiens", "Watson") |
POST /api/v1/tools/pdb.structure/call dynamic
Get full details for a 3D protein structure by PDB ID — title, experimental method (X-ray/cryo-EM/NMR), resolution, molecular weight, chain counts (protein/DNA/RNA), deposit date, primary citation with DOI and PubMed ID. Essential for drug design and structural analysis (RCSB PDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| pdb_id | string | Yes | 4-character PDB identifier (e.g. "4HHB" for hemoglobin, "1BNA" for DNA, "6LU7" for SARS-CoV-2 main protease) |
POST /api/v1/tools/pdb.ligand/call dynamic
Get chemical component data for a ligand/small molecule by its 3-letter PDB code — name, molecular formula, weight, type, formal charge, heavy atom count, SMILES/InChI descriptors. Covers ATP, HEM, NAG, drug molecules, cofactors, ions, and 40K+ chemical entities in the PDB (RCSB PDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ligand_id | string | Yes | Chemical component identifier — standard 3-letter code (e.g. "ATP" for adenosine triphosphate, "HEM" for heme, "NAG" for N-acetylglucosamine, "ZN" for zinc ion) |
POST /api/v1/tools/pdb.sequence/call dynamic
Search protein structures by amino acid sequence similarity (BLAST). Input a protein sequence and find all PDB structures with matching chains. Configure identity cutoff (e.g. 90%) and E-value threshold. Returns PDB entity IDs ranked by similarity score. Essential for homology modeling and structure prediction (RCSB PDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| evalue_cutoff | number | No |
Maximum E-value threshold for BLAST significance. Default: 0.1
default: 0.1
|
| identity_cutoff | number | No |
Minimum sequence identity (0.1-1.0). Default: 0.9 (90% identical)
default: 0.9
|
| limit | integer | No |
Maximum number of results (1-50). Default: 10
default: 10
|
| sequence | string | Yes | Protein amino acid sequence in one-letter code (e.g. "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" — first 50 residues of human hemoglobin alpha) |
POST /api/v1/tools/adzuna.search/call dynamic
Search job listings across 16+ countries (US, UK, AU, CA, DE, FR, and more) by keyword, location, category, salary range. Returns job title, company, salary, location, and apply URL. 70K+ developer jobs in US alone (Adzuna)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No | Job category tag (e.g. "it-jobs", "sales-jobs", "engineering-jobs"). Get tags from adzuna.categories |
| country | string | No |
Country code: us, gb, au, ca, de, fr, nl, in, br, pl, nz, za, sg, at, ch, it, ru (default us)
default: us
|
| full_time | boolean | No | Filter full-time jobs only |
| limit | integer | No |
Max results (1-20, default 10)
default: 10
|
| page | integer | No |
Page number
default: 1
|
| permanent | boolean | No | Filter permanent jobs only |
| salary_max | number | No | Maximum salary filter |
| salary_min | number | No | Minimum salary filter |
| what | string | No | Job search keywords (e.g. "python developer", "marketing manager", "nurse") |
| where | string | No | Location (e.g. "new york", "london", "berlin") |
POST /api/v1/tools/adzuna.categories/call dynamic
List all job categories available in a country — IT, Sales, Engineering, HR, Healthcare, Hospitality, and more. Use category tags to filter adzuna.search results (Adzuna)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No |
Country code (default us)
default: us
|
POST /api/v1/tools/adzuna.salary/call dynamic
Get salary distribution for a job title — returns histogram of salary buckets with job counts. Example: "python developer" in US → $20K-$140K distribution. Use for salary benchmarking and market research (Adzuna)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No |
Country code (default us)
default: us
|
| what | string | No | Job title or keywords for salary histogram (e.g. "python developer", "data scientist") |
| where | string | No | Location for salary data |
POST /api/v1/tools/bdl.games/call dynamic
Get NBA and NFL game results by date — scores, teams, status (Final/In Progress/Scheduled). Filter by date, season, or team. Covers all NBA and NFL games with real-time scores (BallDontLie)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | No | Game date (YYYY-MM-DD, e.g. "2026-03-29"). Returns all games on that date |
| limit | integer | No |
Max results (1-25, default 10)
default: 10
|
| season | integer | No | Season year (e.g. 2025 for 2025-26 season) |
| sport | string | No |
Sport league: "nba" (default) or "nfl"
enum: nba, nfl default: nba
|
| team_id | integer | No | Filter by team ID (get IDs from bdl.teams) |
POST /api/v1/tools/bdl.teams/call dynamic
List NBA and NFL teams with conference, division, city, and abbreviation. Filter by conference (East/West for NBA, AFC/NFC for NFL) or division (BallDontLie)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| conference | string | No | Filter by conference (e.g. "East", "West" for NBA; "AFC", "NFC" for NFL) |
| division | string | No | Filter by division (e.g. "Atlantic", "Pacific" for NBA) |
| limit | integer | No |
Max results (1-30, default 30)
default: 30
|
| sport | string | No |
Sport league: "nba" (default) or "nfl"
enum: nba, nfl default: nba
|
POST /api/v1/tools/bdl.players/call dynamic
Search NBA players by name — returns position, jersey number, and current team. Example: "lebron" → LeBron James #23 F, Los Angeles Lakers (BallDontLie)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No |
Max results (1-25, default 10)
default: 10
|
| search | string | No | Search by player name (e.g. "lebron", "curry", "mahomes") |
| team_id | integer | No | Filter by team ID |
POST /api/v1/tools/postal.lookup/call dynamic
Look up a postal/ZIP code in 60+ countries — returns city name, state/region, and lat/lon coordinates. Supports US, UK, Germany, France, Japan, Brazil, India, Australia, and 50+ more countries. Provide country code (ISO 2-letter) + postal code (Zippopotam.us)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country_code | string | Yes | ISO 3166-1 alpha-2 country code (e.g. "us", "de", "gb", "fr", "jp", "br", "in", "au"). Supports 60+ countries |
| postal_code | string | Yes | Postal/ZIP code (e.g. "90210" for US, "10115" for Germany, "SW1A" for UK, "75001" for France) |
POST /api/v1/tools/dhl.track/call dynamic
Track a DHL shipment by tracking number — returns current status, delivery events timeline, origin/destination, estimated delivery date, and service type. Supports all DHL services: Express, Parcel, eCommerce, Freight. Official DHL data for 220+ countries (DHL)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| tracking_number | string | Yes | DHL tracking number (e.g. "00340434292135100186" for DHL Paket, "1234567890" for DHL Express). Supports all DHL services: Express, Parcel, eCommerce, Freight |
POST /api/v1/tools/ukpost.lookup/call dynamic
Look up a UK postcode — returns district, region, country, ward, parish, parliamentary constituency, and lat/lon coordinates. Backed by ONS/Ordnance Survey data. Example: "SW1A 1AA" → Westminster, London (Postcodes.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| postcode | string | Yes | UK postcode to look up (e.g. "SW1A 1AA" for Westminster, "EC2R 8AH" for City of London, "M1 1AA" for Manchester). Returns district, region, country, lat/lon, parliamentary constituency |
POST /api/v1/tools/ukpost.nearest/call dynamic
Find nearest UK postcodes to a lat/lon coordinate — returns postcodes sorted by distance with district info. Use for reverse geocoding in the UK (Postcodes.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| lat | number | Yes | Latitude (e.g. 51.5074 for London) |
| limit | integer | No |
Max results (1-10, default 5)
default: 5
|
| lon | number | Yes | Longitude (e.g. -0.1278 for London) |
POST /api/v1/tools/ukpost.validate/call dynamic
Check if a UK postcode is valid and exists — returns true/false. Use for form validation or data cleaning (Postcodes.io)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| postcode | string | Yes | UK postcode to validate (e.g. "SW1A 1AA"). Returns true if valid format and exists |
POST /api/v1/tools/shipengine.rates/call dynamic
Compare shipping rates across multiple carriers (USPS, UPS, FedEx, DHL) for a package. Provide origin/destination ZIP codes, weight in pounds, and optional dimensions. Returns sorted rates with price, delivery time, and service type. Up to 84% off retail rates (ShipEngine)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| from_country | string | No |
Origin country code (default US)
default: US
|
| from_zip | string | Yes | Origin US ZIP code (e.g. "10001" for NYC) |
| height | number | No | Package height in inches |
| length | number | No | Package length in inches |
| to_country | string | No |
Destination country code (default US)
default: US
|
| to_zip | string | Yes | Destination US ZIP code (e.g. "90210" for Beverly Hills) |
| weight_lb | number | Yes | Package weight in pounds (e.g. 5) |
| width | number | No | Package width in inches |
POST /api/v1/tools/shipengine.validate/call dynamic
Validate and standardize a US address — returns USPS-verified address with corrected spelling, ZIP+4, and validation status. Catches typos, missing info, and invalid addresses before shipping (ShipEngine)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| address_line1 | string | Yes | Street address (e.g. "1 E 161 St") |
| address_line2 | string | No | Apartment, suite, unit (e.g. "Apt 4B") |
| city | string | No | City name (e.g. "Bronx") |
| country | string | No |
Country code (default US)
default: US
|
| postal_code | string | No | ZIP code (e.g. "10451") |
| state | string | No | State code (e.g. "NY") |
POST /api/v1/tools/shipengine.carriers/call dynamic
List all connected shipping carriers with their IDs and codes. Shows which carriers are available for rate comparison (USPS, UPS, FedEx, DHL, etc.) (ShipEngine)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No | Optional filter on carrier name (e.g. "ups", "usps"). Returns all connected carriers if omitted |
POST /api/v1/tools/weatherapi.current/call dynamic
Get current weather conditions for any location worldwide — temperature, wind, humidity, pressure, UV index, cloud cover, feels-like temp. Accepts city name, coordinates, zip code, or airport code. 100K+ stations globally (WeatherAPI.com)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| q | string | Yes | Location query — city name (e.g. "London"), coordinates ("48.8,2.35"), US zip ("10001"), UK postcode ("SW1"), IP address, or IATA airport code ("JFK") |
POST /api/v1/tools/weatherapi.forecast/call dynamic
Get 3-day weather forecast — daily min/max temperature, conditions, wind, precipitation, humidity, rain/snow chance, UV index. Accepts any location query (WeatherAPI.com)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| days | integer | No |
Forecast days (1-3, default 3)
default: 3
|
| q | string | Yes | Location query — city name, coordinates, zip code, or airport code |
POST /api/v1/tools/weatherapi.astronomy/call dynamic
Get sunrise, sunset, moonrise, moonset times and moon phase for any location and date. Returns moon illumination percentage and phase name (WeatherAPI.com)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | No | Date for astronomy data (YYYY-MM-DD, default today) |
| q | string | Yes | Location query — city name, coordinates, or zip code |
POST /api/v1/tools/weatherapi.search/call dynamic
Search and autocomplete location names — returns matching cities with coordinates. Type partial name (e.g. "lon" → London, "mos" → Moscow). Use result coordinates with other weather tools (WeatherAPI.com)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| q | string | Yes | Search query — partial city name for autocomplete (e.g. "lon" → London, "mos" → Moscow) |
POST /api/v1/tools/code.execute/call dynamic
⚡ ACTION: Execute source code in a sandboxed environment — 71 programming languages supported (Python, JavaScript, Java, C++, Go, Rust, C#, Bash, Ruby, PHP, and 60+ more). Returns stdout, stderr, execution time, and memory usage. Safe sandboxed execution with CPU/memory limits. Use code.languages to get language IDs (Judge0 CE)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| cpu_time_limit | number | No | CPU time limit in seconds (default 5, max 15) |
| language_id | integer | Yes | Language ID from code.languages (e.g. 71=Python 3, 63=JavaScript, 62=Java, 54=C++, 60=Go, 73=Rust, 51=C#, 46=Bash). Call code.languages for full list |
| memory_limit | number | No | Memory limit in KB (default 128000 = 128MB) |
| source_code | string | Yes | Source code to execute |
| stdin | string | No | Standard input to feed to the program |
POST /api/v1/tools/code.languages/call dynamic
List all 71 available programming languages and their IDs for code execution. Common IDs: 71=Python 3.8, 63=JavaScript (Node.js), 62=Java, 54=C++ (GCC), 60=Go, 73=Rust, 51=C#, 46=Bash. Returns full list with compiler/interpreter versions (Judge0 CE)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| filter | string | No | Optional filter — substring match on language name (e.g. "python", "java", "rust"). Returns all 71 languages if omitted |
POST /api/v1/tools/scrape.extract/call dynamic
⚡ ACTION: Extract raw HTML from any URL — cheapest web scraping API ($0.00013 for simple sites). Returns decoded HTML content, HTTP status code, and content length. Use for data extraction, content analysis, or price monitoring. Handles anti-bot protection automatically (Zyte)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| url | string | Yes | URL to scrape — returns raw HTML content. Fast and cheap ($0.00013 for simple sites). Example: "https://example.com" |
POST /api/v1/tools/scrape.browser/call dynamic
⚡ ACTION: Render a URL with headless browser and return JS-rendered HTML. Use for SPAs, React/Vue apps, or pages with dynamic content that raw HTTP cannot capture. Returns fully rendered DOM as HTML text (Zyte)
- Amount
- 0.015000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.015000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| url | string | Yes | URL to render with headless browser — returns JS-rendered HTML. Use for SPAs, dynamic content. More expensive than extract. Example: "https://example.com" |
POST /api/v1/tools/scrape.screenshot/call dynamic
⚡ ACTION: Capture a full-page screenshot of any URL — returns base64-encoded PNG image. Use for visual verification, monitoring, or archiving. Headless browser renders the page before capture (Zyte)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| url | string | Yes | URL to screenshot — returns base64-encoded PNG image. Use for visual verification or page capture. Example: "https://example.com" |
POST /api/v1/tools/carmarket.search/call dynamic
Search millions of active US car listings by make, model, year, price range, mileage, ZIP code, and radius. Returns VIN, price, miles, dealer info, Carfax status, and days on market. Filter by seller type (dealer/private) and color. Data from all major US marketplaces (MarketCheck)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| exterior_color | string | No | Filter by exterior color (e.g. "White", "Black", "Red") |
| limit | integer | No |
Max results (1-25, default 10)
default: 10
|
| make | string | No | Car manufacturer (e.g. "Toyota", "Honda", "BMW", "Tesla") |
| miles_max | number | No | Maximum mileage |
| model | string | No | Car model (e.g. "Camry", "Civic", "Model 3") |
| price_max | number | No | Maximum price in USD |
| price_min | number | No | Minimum price in USD |
| radius | number | No | Search radius in miles from ZIP (max 100 on free tier) |
| seller_type | string | No |
Filter by seller type
enum: dealer, private |
| start | integer | No | Offset for pagination |
| year | integer | No | Model year (e.g. 2023, 2024) |
| zip | string | No | US ZIP code to search near (e.g. "10001") |
POST /api/v1/tools/carmarket.listing/call dynamic
Get full details for a specific car listing by ID — VIN, price, MSRP, mileage, full build specs (engine, transmission, drivetrain, fuel type), dealer contact, Carfax 1-owner status, days on market, photos. Get listing IDs from carmarket.search (MarketCheck)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | string | Yes | MarketCheck listing ID (e.g. "3TMCZ5AN5PM564843-883937ce-f335"). Get IDs from carmarket.search results |
POST /api/v1/tools/threatintel.reputation/call dynamic
Get domain reputation score (0-100) with detailed security test results — WHOIS age, SSL validity, mail server config, blacklist status, and more. Higher score = safer domain. Essential for security agents evaluating domain trustworthiness (Threat Intelligence Platform)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to check reputation (e.g. "google.com", "suspicious-site.xyz"). Returns reputation score 0-100 and security test results |
POST /api/v1/tools/threatintel.malware/call dynamic
Check if a domain is associated with malware, phishing, or other threats. Returns safe score (0-100) and detailed warning descriptions. Use for URL safety verification before agent navigation (Threat Intelligence Platform)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to check for malware and phishing (e.g. "example.com"). Returns safe score 0-100 and warning details |
POST /api/v1/tools/threatintel.infrastructure/call dynamic
Analyze domain infrastructure — all associated IPv4 addresses, geolocation (country, city, region), subnets, and resource types (web, mail, DNS). Reveals hosting setup, CDN usage, and geographic distribution (Threat Intelligence Platform)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to analyze infrastructure (e.g. "google.com"). Returns all associated IPs, geolocation, subnets, and resource types |
POST /api/v1/tools/listennotes.search/call dynamic
Full-text search across 3.7M+ podcasts and 186M+ episodes. Search by keyword, filter by language and genre, sort by relevance or date. Returns episode titles, podcast names, audio URLs, and duration. The most comprehensive podcast search API available (Listen Notes)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| genre_ids | string | No | Comma-separated genre IDs to filter (e.g. "93,127" for Business+Technology). See Listen Notes genre list |
| language | string | No | ISO 639-1 language code (e.g. "en", "es", "fr"). Filters results by podcast language |
| limit | integer | No |
Max results (1-10, default 10)
default: 10
|
| offset | integer | No | Offset for pagination |
| q | string | Yes | Search query — full-text search across 186M+ podcast episodes and 3.7M+ podcasts (e.g. "artificial intelligence", "startup funding", "true crime") |
| sort_by_date | boolean | No | Sort by date (true) or relevance (false, default) |
| type | string | No |
Search type: "episode" (default) searches episode titles/descriptions, "podcast" searches podcast-level metadata
enum: episode, podcast default: episode
|
POST /api/v1/tools/listennotes.podcast/call dynamic
Get full details for a podcast by Listen Notes ID — title, publisher, description, episode count, language, country, website, genres, and latest publish date. Use IDs from listennotes.search or listennotes.best (Listen Notes)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | string | Yes | Listen Notes podcast ID (e.g. "4d3fe717742d4963a85562e9f84d8c79"). Get IDs from listennotes.search or listennotes.best |
POST /api/v1/tools/listennotes.best/call dynamic
Get curated lists of the best podcasts by genre — Technology (127), Business (93), TV & Film (68), Sports (77), Leisure (82), and 60+ more genres. Paginated, returns podcast titles, publishers, episode counts, and descriptions (Listen Notes)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| genre_id | integer | No | Genre ID to filter (e.g. 93=Business, 127=Technology, 68=TV & Film, 82=Leisure, 77=Sports). Omit for overall best |
| page | integer | No |
Page number (default 1)
default: 1
|
POST /api/v1/tools/audd.recognize/call dynamic
Identify a song from an audio file URL — like Shazam for AI agents. Analyzes audio fingerprint against 80M+ tracks and returns artist, title, album, release date, plus Spotify and Apple Music links. Accepts MP3, WAV, OGG, or any audio URL (AudD)
- Amount
- 0.007000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.007000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| url | string | Yes | URL of audio file to identify (MP3, WAV, OGG, etc.). The API analyzes the audio and matches it against 80M+ tracks. Example: "https://example.com/song.mp3" |
POST /api/v1/tools/audd.lyrics/call dynamic
Search for song lyrics by artist name, song title, or both. Returns full lyrics text, artist, title, and metadata. Query examples: "imagine john lennon", "bohemian rhapsody", "taylor swift love story" (AudD)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| q | string | Yes | Search query for lyrics — artist name, song title, or both (e.g. "imagine john lennon", "bohemian rhapsody", "taylor swift love story") |
POST /api/v1/tools/materials.search/call dynamic
Search 150,000+ inorganic materials by chemical formula, elements, band gap, stability, or metallic character. Returns DFT-computed properties: band gap, formation energy, density, crystal system. Filter semiconductors (band_gap 1-3 eV), stable battery cathodes (elements Li,Fe,O + is_stable), or metals. DOE/Lawrence Berkeley Lab data, CC BY 4.0 (Materials Project)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| band_gap_max | number | No | Maximum band gap in eV (e.g. 3.0). Use with band_gap_min for range filter |
| band_gap_min | number | No | Minimum band gap in eV (e.g. 1.0). Use with band_gap_max for range filter |
| elements | string | No | Comma-separated elements to filter (e.g. "Li,Fe,O" — returns materials containing these elements) |
| formula | string | No | Chemical formula to search (e.g. "Si", "Fe2O3", "LiFePO4"). Exact or reduced formula |
| is_metal | boolean | No | Filter for metals (true) or non-metals (false) |
| is_stable | boolean | No | Filter for thermodynamically stable materials only (energy_above_hull = 0) |
| limit | integer | No |
Max results (1-50, default 10)
default: 10
|
| skip | integer | No | Offset for pagination |
POST /api/v1/tools/materials.details/call dynamic
Get full DFT-computed properties for a material by Materials Project ID (e.g. mp-149 for silicon). Returns: band gap, formation energy, thermodynamic stability, density, crystal structure, spacegroup, magnetism, bulk/shear modulus, Poisson ratio, Fermi energy, database cross-references. 150K+ materials (Materials Project)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| material_id | string | Yes | Materials Project ID (e.g. "mp-149" for silicon, "mp-19017" for LiFePO4). Get IDs from materials.search |
POST /api/v1/tools/materials.elasticity/call dynamic
Get mechanical/elastic properties for a material: bulk modulus, shear modulus (Voigt-Reuss-Hill averages), universal anisotropy index, Poisson ratio, and full 6x6 elastic tensor (IEEE format). Essential for structural materials screening and mechanical simulations (Materials Project)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| material_id | string | Yes | Materials Project ID (e.g. "mp-149"). Returns bulk/shear modulus, Poisson ratio, elastic tensor |
POST /api/v1/tools/tracking.register/call dynamic
⚡ ACTION: Register a tracking number to begin monitoring shipment status. Auto-detects carrier from 3,200+ supported carriers worldwide (UPS, FedEx, DHL, USPS, China Post, Royal Mail, etc.). Must be called before tracking.status. Returns detected carrier and registration status. Consumes quota — 200 free/month (17TRACK)
- Amount
- 0.025000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.025000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| tag | string | No | Optional label for this shipment (e.g. order ID, customer reference). Up to 50 characters |
| tracking_number | string | Yes | Package tracking number (e.g. "1Z999AA10123456784" for UPS, "9400111899560243888780" for USPS). Carrier is auto-detected from 3,200+ supported carriers |
POST /api/v1/tools/tracking.status/call dynamic
Get full tracking timeline for a registered package — latest status, all carrier scan events with timestamps and locations, delivery milestones, transit days, origin/destination countries. Supports 3,200+ carriers across 220 countries. Call tracking.register first if number is not yet registered (17TRACK)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| tracking_number | string | Yes | Tracking number previously registered with tracking.register. Returns full event timeline, carrier info, milestones, and delivery status |
POST /api/v1/tools/tracking.list/call dynamic
List all tracking numbers registered in your account with status summary — package status, latest event, transit days, registration time. Paginated. Filter by status: NotFound, InTransit, Delivered, Expired, Exception (17TRACK)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| page | integer | No |
Page number (default 1)
default: 1
|
| page_size | integer | No |
Results per page (1-100, default 20)
default: 20
|
| status | string | No |
Filter by package status
enum: NotFound, InTransit, Delivered, Expired, Exception |
POST /api/v1/tools/account.usage/call dynamic
Get your API usage summary — total calls, total cost, cache hit rate, average latency, and unique tools used. Filter by period: 1 day, 7 days, or 30 days. See how efficiently you are using the platform. Free, no charge (APIbase)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| period | string | No |
Time period for usage stats: "1d" (24 hours), "7d" (7 days), or "30d" (30 days). Default: "7d"
enum: 1d, 7d, 30d default: 7d
|
POST /api/v1/tools/account.tools/call dynamic
Get per-tool usage breakdown — calls, cost, cache hits, average latency, last used. Sort by cost (highest spend), calls (most used), or latency (slowest). Identify your most-used and most-expensive tools. Free, no charge (APIbase)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No |
Max number of tools to return (1-100). Default: 20
default: 20
|
| sort | string | No |
Sort tools by: "cost" (highest spend), "calls" (most used), or "latency" (slowest). Default: "calls"
enum: cost, calls, latency default: calls
|
POST /api/v1/tools/account.timeseries/call dynamic
Get time-series usage data — calls, cost, cache hits per hour or day over a period. Visualize usage patterns and trends. Choose granularity: hourly (for 1d period) or daily (for 7d/30d). Free, no charge (APIbase)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| granularity | string | No |
Time bucket granularity: "hour" or "day". Default: "day"
enum: hour, day default: day
|
| period | string | No |
Time period: "1d", "7d", or "30d". Default: "7d"
enum: 1d, 7d, 30d default: 7d
|
POST /api/v1/tools/platform.tool_quality/call dynamic
Get quality metrics for any tool — uptime percentage, p50/p95 latency, error rate, total calls in last 24h. Check reliability before calling expensive tools. Updated every 10 minutes. Free, no charge (APIbase)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| tool_id | string | Yes | Tool ID to get quality metrics for (e.g. "crypto.get_price", "weather.get_current") |
POST /api/v1/tools/platform.tool_rankings/call dynamic
Get ranked list of tools by quality — sort by uptime (most reliable), latency (fastest), or error_rate (fewest errors). Filter by category (e.g. "crypto", "weather"). Discover the best tools for your use case. Free, no charge (APIbase)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No | Filter by tool category prefix (e.g. "crypto", "weather", "finance") |
| limit | integer | No |
Max number of tools to return (1-100). Default: 20
default: 20
|
| sort | string | No |
Sort by: "uptime" (highest availability), "latency" (fastest p50), or "error_rate" (lowest errors). Default: "uptime"
enum: uptime, latency, error_rate default: uptime
|
POST /api/v1/tools/platform.call_batch/call dynamic
⚡ ACTION: Execute up to 20 tool calls in a single request with parallel execution (max 10 concurrent). Each call runs the full pipeline independently with its own billing. Returns array of results with per-call status, data, cost, and duration. Save 5x round-trips vs sequential calls. Batch wrapper is free — you pay only for individual tool calls (APIbase)
- Amount
- 0.000000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.000000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| calls | array | Yes | Array of tool calls to execute in parallel (max 20) |
| max_parallel | integer | No |
Max concurrent calls (1-10). Default: 10
default: 10
|
POST /api/v1/tools/theirstack.jobs/call dynamic
Search 181M+ job postings worldwide — filter by keywords, country, remote, tech stack, recency. Returns title, company, location, salary range, post date. Job market intelligence for hiring analysis and talent sourcing (TheirStack)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "DE", "IN") |
| days | integer | No | Max age in days (1-90). Only jobs posted within this window |
| keywords | string | No | Comma-separated job title keywords (e.g. "python developer, backend engineer"). Matches job_title_or filter |
| limit | integer | No |
Max results (1-25, default 10)
default: 10
|
| remote | boolean | No | Filter remote-only jobs |
| technologies | string | No | Comma-separated tech stack filter (e.g. "kubernetes, python, react"). Matches technologies_or |
POST /api/v1/tools/theirstack.companies/call dynamic
Find companies by technology stack — filter by technologies (kubernetes, react, python...), country, minimum active jobs. Returns company name, URL, job count, tech stack. Identify employers using specific technologies (TheirStack)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO 3166-1 alpha-2 country code (e.g. "US", "DE", "IN") |
| limit | integer | No |
Max results (1-25, default 10)
default: 10
|
| min_jobs | integer | No | Minimum number of active job postings |
| technologies | string | No | Comma-separated tech stack filter (e.g. "kubernetes, docker, aws"). Find companies using these technologies |
POST /api/v1/tools/jooble.search/call dynamic
Search aggregated job listings across 70+ countries — filter by keywords, location, radius, salary, company name. Returns title, company, location, salary, source, direct link. 9M+ active listings from thousands of job boards (Jooble)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| company_search | boolean | No | Set true to search by company name instead of job title |
| keywords | string | No | Job search keywords (e.g. "python developer", "marketing manager", "nurse") |
| limit | integer | No |
Max results per page (1-20, default 10)
default: 10
|
| location | string | No | Location (e.g. "New York", "London", "Berlin", "Remote") |
| page | integer | No |
Page number (default 1)
default: 1
|
| radius | string | No |
Search radius in km from location: 0, 4, 8, 16, 26, 40, or 80
enum: 0, 4, 8, 16, 26, 40, 80 |
| salary | number | No | Minimum salary filter (numeric) |
POST /api/v1/tools/arbeitnow.jobs/call dynamic
Browse European job listings — 100 jobs per page sorted by newest. Returns title, company, location, remote flag, tags, job types, direct link. Updated hourly. EU-focused: Germany, Austria, Switzerland, Netherlands, and more. Open public API (Arbeitnow)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| page | integer | No |
Page number (default 1). Each page returns ~100 EU job listings sorted by newest first. No server-side search — use page to browse
default: 1
|
POST /api/v1/tools/reed.search/call dynamic
Search UK job listings — filter by keywords, location, distance, salary range (GBP), contract type (permanent/contract/temp), full/part time. Returns title, company, salary, applications count, direct link. UK largest job board (Reed.co.uk)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| contract | boolean | No | Filter contract positions only |
| distance | integer | No | Search radius in miles from location (default 10) |
| full_time | boolean | No | Filter full-time positions only |
| keywords | string | No | Job search keywords (e.g. "python developer", "data scientist", "nurse") |
| limit | integer | No |
Max results (1-100, default 25)
default: 25
|
| location | string | No | UK location — city, town, or postcode (e.g. "London", "Manchester", "SW1A 1AA") |
| part_time | boolean | No | Filter part-time positions only |
| permanent | boolean | No | Filter permanent positions only |
| salary_max | number | No | Maximum annual salary in GBP (e.g. 80000) |
| salary_min | number | No | Minimum annual salary in GBP (e.g. 30000) |
| skip | integer | No | Number of results to skip for pagination (must be divisible by limit) |
POST /api/v1/tools/reed.details/call dynamic
Get full details of a UK job listing by ID — title, company, full salary info (min/max GBP, annual/hourly/daily), contract type, full/part time, application count, full HTML description, external apply URL. Use job IDs from reed.search results (Reed.co.uk)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| job_id | integer | Yes | Reed job ID (from search results). Example: 56448344 |
POST /api/v1/tools/remotive.search/call dynamic
Search curated remote-only job listings — filter by keywords and category (software-dev, design, marketing, data, devops, etc.). Returns title, company, salary, job type, location requirements, tags. Global remote positions only (Remotive)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| category | string | No | Job category slug: software-dev, design, customer-support, writing, marketing, sales, product, business, data, devops, finance, hr, qa, all-others |
| limit | integer | No |
Max results (1-50, default 20)
default: 20
|
| search | string | No | Job search keywords (e.g. "python", "react developer", "product manager") |
POST /api/v1/tools/canopy.search/call dynamic
Search Amazon products by keyword — filter by price range, sort by relevance/price/rating/reviews/newest. Returns title, ASIN, price, rating, Prime flag, image. 12 marketplaces: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (Canopy API)
- Amount
- 0.012000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.012000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | No |
Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)
default: US
|
| page | integer | No | Page number for pagination |
| price_max | number | No | Maximum price filter (in marketplace currency) |
| price_min | number | No | Minimum price filter (in marketplace currency) |
| query | string | Yes | Search keywords (e.g. "wireless headphones", "raspberry pi 5") |
| sort | string | No |
Sort order: relevance, price_asc, price_desc, rating, reviews, newest
enum: relevance, price_asc, price_desc, rating, reviews, newest |
POST /api/v1/tools/canopy.product/call dynamic
Get full Amazon product details by ASIN — title, brand, price, rating, stock status, feature bullets, categories, seller name. Use ASINs from canopy.search. 12 Amazon marketplaces supported (Canopy API)
- Amount
- 0.012000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.012000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| asin | string | Yes | Amazon ASIN product ID (e.g. "B0CRSNCJ6Y"). Get ASINs from canopy.search |
| domain | string | No |
Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)
default: US
|
POST /api/v1/tools/canopy.offers/call dynamic
Get all third-party seller offers for an Amazon product — price, condition (new/used), seller name & rating, Buy Box winner flag, Fulfilled by Amazon, delivery estimate. Price comparison across sellers (Canopy API)
- Amount
- 0.012000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.012000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| asin | string | Yes | Amazon ASIN product ID. Returns all third-party offers with Buy Box winner, seller ratings, delivery info |
| domain | string | No |
Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)
default: US
|
POST /api/v1/tools/canopy.deals/call dynamic
Browse current Amazon deals — original price vs deal price, product title, ASIN, deal link. Paginated, 500+ active deals. 12 Amazon marketplaces (Canopy API)
- Amount
- 0.012000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.012000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | No |
Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)
default: US
|
| page | integer | No | Page number (default 1) |
POST /api/v1/tools/spider.scrape/call dynamic
Scrape any web page and get clean content — markdown (default), plain text, or raw HTML. Handles JavaScript rendering, anti-bot bypass, proxy rotation. Returns LLM-ready output. Cheapest web scraper with PAYG pricing (Spider.cloud)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| format | string | No |
Output format: markdown (default, best for LLMs), text (plain), raw (HTML), commonmark
enum: markdown, text, raw, commonmark default: markdown
|
| readability | boolean | No | Enable readability mode — pre-processes page for LLM consumption |
| url | string | Yes | URL to scrape (e.g. "https://example.com/page") |
| wait_for | integer | No | Wait N ms for JS to render before scraping (0-30000) |
POST /api/v1/tools/spider.search/call dynamic
Web search that returns page titles, descriptions, and URLs. Combine with spider.scrape to get full content. Results ranked by relevance (Spider.cloud)
- Amount
- 0.005000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.005000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No |
Max results (1-20, default 5)
default: 5
|
| query | string | Yes | Web search query (e.g. "best MCP servers 2026") |
POST /api/v1/tools/imgflip.memes/call dynamic
Get top 100 popular meme templates — Drake Hotline Bling, Two Buttons, Distracted Boyfriend, and more. Returns template ID, name, image URL, box count. Use IDs with imgflip.caption to generate memes (Imgflip)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| search | string | No | Optional: filter memes by name (client-side). Returns top 100 popular meme templates. |
POST /api/v1/tools/imgflip.caption/call dynamic
⚡ ACTION: Generate a captioned meme image from a template ID + top/bottom text. Returns direct image URL. Use imgflip.memes to find template IDs. 100K+ templates available (Imgflip)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| bottom_text | string | No | Bottom text on the meme |
| template_id | string | Yes | Meme template ID from imgflip.memes (e.g. "181913649" for Drake Hotline Bling, "87743020" for Two Buttons) |
| top_text | string | No | Top text on the meme |
POST /api/v1/tools/cocktail.search/call dynamic
Search 10,000+ cocktail recipes by name or filter by ingredient. Returns name, category, glass type, instructions, ingredients with measures, image. Search "margarita" or filter by "Vodka" (TheCocktailDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ingredient | string | No | Filter by ingredient (e.g. "Vodka", "Rum", "Gin"). Returns cocktails containing this ingredient. Use name OR ingredient, not both. |
| name | string | No | Cocktail name to search (e.g. "margarita", "mojito", "old fashioned") |
POST /api/v1/tools/cocktail.random/call dynamic
Get a random cocktail recipe with full details — name, category, glass, instructions, ingredients, measures, image. Great for discovery and recommendations (TheCocktailDB)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| count | integer | No |
Always returns 1 random cocktail with full recipe
default: 1
|
POST /api/v1/tools/github.search_repos/call dynamic
Search GitHub repositories by keyword, language, stars, topics. Returns name, description, stars, forks, language, license, owner. Sort by stars/forks/updated. 86K+ MCP repos, 372M+ total repos (GitHub API)
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No |
Max results (1-30, default 10)
default: 10
|
| query | string | Yes | Search query (e.g. "mcp server", "react framework", "language:python stars:>1000") |
| sort | string | No |
Sort by: stars (default), forks, updated, help-wanted-issues
enum: stars, forks, updated, help-wanted-issues default: stars
|
POST /api/v1/tools/github.user/call dynamic
Get a GitHub user profile — name, bio, public repos count, followers, company, location, join date. Works for users and organizations (GitHub API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| username | string | Yes | GitHub username (e.g. "torvalds", "whiteknightonhorse") |
POST /api/v1/tools/github.repo/call dynamic
Get full details of a GitHub repository — description, stars, forks, language, topics, license, last update. Public repos only (GitHub API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| owner | string | Yes | Repository owner (e.g. "facebook", "microsoft") |
| repo | string | Yes | Repository name (e.g. "react", "vscode") |
POST /api/v1/tools/wikidata.search/call dynamic
Search 100M+ structured entities in Wikidata — people, companies, places, concepts. Returns entity ID, label, description. Use IDs with wikidata.entity for full details. CC-0 public domain (Wikidata)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| language | string | No |
Language code for labels (e.g. "en", "de", "fr", "ja"). Default: en
default: en
|
| limit | integer | No |
Max results (1-20, default 10)
default: 10
|
| query | string | Yes | Search query (e.g. "Tesla", "Barack Obama", "JavaScript", "Mount Everest") |
POST /api/v1/tools/wikidata.entity/call dynamic
Get structured data for a Wikidata entity by ID (e.g. Q42 = Douglas Adams). Returns labels, descriptions, aliases, and up to 20 property statements. 300+ languages supported. CC-0 (Wikidata)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | string | Yes | Wikidata entity ID (e.g. "Q42" for Douglas Adams, "Q478214" for Tesla Inc). Get IDs from wikidata.search |
POST /api/v1/tools/dictionary.define/call dynamic
Get word definition — phonetic pronunciation, part of speech, definitions with examples, synonyms, antonyms, audio URL. Supports 12 languages: en, es, fr, de, it, pt, ru, ar, hi, ja, ko, zh (Free Dictionary API)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| language | string | No |
Language code: en, es, fr, de, it, pt, ru, ar, hi, ja, ko, zh (default: en)
default: en
|
| word | string | Yes | Word to define (e.g. "algorithm", "serendipity", "ubuntu") |
POST /api/v1/tools/dictionary.words/call dynamic
Find words by meaning, sound, rhyme, or spelling pattern. "happy" → pleased, blissful. "algorithm" rhymes → rhythm, logarithm. Great for writing, creative tasks, word games (Datamuse)
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No |
Max results (1-25, default 10)
default: 10
|
| meaning | string | No | Find words with this meaning (e.g. "happy" → pleased, blissful, content) |
| rhymes_with | string | No | Find words that rhyme with this (e.g. "algorithm" → rhythm, logarithm) |
| sounds_like | string | No | Find words that sound like this (e.g. "elefant" → elephant) |
| starts_with | string | No | Find words starting with these letters (e.g. "algor" → algorithm, algorithmic) |
POST /api/v1/tools/noaa.forecast/call dynamic
Get 7-day weather forecast for a US location by latitude/longitude. Returns day and night periods with temperature (°F), precipitation chance, wind speed/direction, and detailed forecast text. Powered by NOAA National Weather Service (api.weather.gov). US contiguous only.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| latitude | number | Yes | Latitude in decimal degrees (US contiguous only: 24–50) |
| longitude | number | Yes | Longitude in decimal degrees (US contiguous only: −125 to −66) |
POST /api/v1/tools/noaa.hourly/call dynamic
Get hourly weather forecast (next 48 hours) for a US location by latitude/longitude. Returns temperature (°F), precipitation chance, wind speed/direction, and short conditions per hour. Powered by NOAA National Weather Service. US contiguous only.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| latitude | number | Yes | Latitude in decimal degrees (US contiguous only: 24–50) |
| longitude | number | Yes | Longitude in decimal degrees (US contiguous only: −125 to −66) |
POST /api/v1/tools/noaa.observation/call dynamic
Get latest weather observation from the nearest ASOS/AWOS station to a US location. Returns current temperature (°C/°F), humidity, wind, pressure, visibility, dewpoint, heat index, wind chill. Powered by NOAA National Weather Service. US contiguous only.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| latitude | number | Yes | Latitude in decimal degrees (US contiguous only: 24–50) |
| longitude | number | Yes | Longitude in decimal degrees (US contiguous only: −125 to −66) |
POST /api/v1/tools/whoisjson.ssl_check/call dynamic
Validate SSL/TLS certificate for any domain. Returns issuer (org, CN), validity dates, subject CN, wildcard status, key size, and Subject Alternative Names (SAN) list. Useful for security audits, monitoring cert expiration, and verifying HTTPS configuration (WhoisJSON)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to check SSL certificate (e.g. google.com, apibase.pro) |
POST /api/v1/tools/whoisjson.subdomains/call dynamic
Discover subdomains for any domain via DNS brute-force enumeration. Returns subdomain names, DNS record types (A/CNAME/MX), resolved IPs, and active/inactive status. Useful for security reconnaissance, asset inventory, and infrastructure mapping (WhoisJSON)
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| domain | string | Yes | Domain name to discover subdomains (e.g. github.com, example.com) |
POST /api/v1/tools/npm.package_info/call dynamic
Get metadata for any npm package: version, description, license, dependencies, maintainers, repository URL, keywords, engines. 2.1M+ packages. Supports scoped packages (@scope/name). Returns latest version by default or a specific version.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | npm package name (e.g. express, react, @anthropic-ai/sdk) |
| version | string | No | Specific version to fetch (e.g. 5.2.1). Defaults to latest |
POST /api/v1/tools/npm.downloads/call dynamic
Get download count for any npm package over a time period: last-day, last-week, last-month, last-year. Useful for measuring package popularity, adoption trends, and comparing alternatives (e.g. express: 92M/week).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | npm package name (e.g. express, lodash, typescript) |
| period | string | No |
Time period for download stats (default: last-week)
enum: last-day, last-week, last-month, last-year |
POST /api/v1/tools/npm.search/call dynamic
Search 2.1M+ npm packages by keyword. Returns ranked results with quality, popularity, and maintenance scores, download counts, dependents, license, publisher. Find libraries for any task (e.g. "mcp server", "react hooks", "typescript orm").
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| query | string | Yes | Search query (e.g. "mcp server", "react hooks", "typescript orm") |
| size | integer | No | Number of results to return (1-20, default 10) |
POST /api/v1/tools/npm.versions/call dynamic
List all published versions of an npm package with dist-tags (latest, next, beta), deprecation status, and total version count. Returns the 50 most recent versions. Useful for dependency auditing and upgrade planning.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | npm package name to list all versions (e.g. express, react) |
POST /api/v1/tools/osv.query/call dynamic
Check known vulnerabilities for a specific package version in any ecosystem (npm, PyPI, Go, Maven, Rust, NuGet, 14+ more). Returns CVE/GHSA IDs, severity scores, and affected package counts. Powered by Google OSV.dev — aggregates GitHub Security Advisories, NVD, and ecosystem-native databases.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| ecosystem | string | Yes |
Package ecosystem (npm, PyPI, Go, Maven, crates.io, NuGet, Packagist, RubyGems, etc.)
enum: npm, PyPI, Go, Maven, crates.io, NuGet, Packagist, RubyGems, Pub, Hex, SwiftURL, Linux, Android, OSS-Fuzz, GIT |
| package | string | Yes | Package name (e.g. lodash, requests, gin-gonic/gin) |
| version | string | Yes | Package version to check (e.g. 4.17.20, 2.25.0) |
POST /api/v1/tools/osv.get/call dynamic
Retrieve full details for a vulnerability by OSV ID (GHSA-xxxx), CVE ID (CVE-2021-xxxxx), or ecosystem ID (PYSEC/RUSTSEC/GO). Returns summary, CVSS severity, affected packages with fix versions, and reference links.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| vuln_id | string | Yes | Vulnerability ID — OSV (e.g. GHSA-35jh-r3h4-6jhm), CVE (e.g. CVE-2021-23337), or PYSEC/GO/RUSTSEC ID |
POST /api/v1/tools/osv.batch_query/call dynamic
Scan up to 100 packages at once for known vulnerabilities. Submit package+version+ecosystem triples (e.g. full requirements.txt or package.json dependencies) and get vulnerability matches for all in a single call. Ideal for full dependency tree security audits.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| queries | array | Yes | List of package+version+ecosystem to check (max 100) |
POST /api/v1/tools/census.population/call dynamic
Get population counts for any US geography by FIPS code — total, male, female. Covers all 50 states, 3,000+ counties, and sub-county areas. Source: American Community Survey 5-year estimates (US Census Bureau). Public domain, updated annually.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| county_fips | string | No | County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data. |
| state_fips | string | Yes | US state FIPS code (e.g. 06 for California, 36 for New York, * for all states) |
| year | integer | No | Survey year (default 2022). ACS 5-year estimates available 2010-2022. |
POST /api/v1/tools/census.demographics/call dynamic
Get demographic composition for any US geography — median age, race (white/Black/Asian), Hispanic/Latino population, and bachelor's degree attainment. Source: ACS 5-year estimates (US Census Bureau). Useful for market research, policy analysis, and neighborhood profiling.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| county_fips | string | No | County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data. |
| state_fips | string | Yes | US state FIPS code (e.g. 06 for California, 36 for New York, * for all states) |
| year | integer | No | Survey year (default 2022). ACS 5-year estimates available 2010-2022. |
POST /api/v1/tools/census.economic/call dynamic
Get economic indicators for any US geography — median household income, population in poverty, and unemployed count. Source: ACS 5-year estimates (US Census Bureau). Key data for market sizing, real estate analysis, and business location intelligence.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| county_fips | string | No | County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data. |
| state_fips | string | Yes | US state FIPS code (e.g. 06 for California, 36 for New York, * for all states) |
| year | integer | No | Survey year (default 2022). ACS 5-year estimates available 2010-2022. |
POST /api/v1/tools/census.housing/call dynamic
Get housing statistics for any US geography — total units, median home value, median rent, owner-occupied vs renter-occupied counts. Source: ACS 5-year estimates (US Census Bureau). Essential for real estate agents, property valuations, and housing market analysis.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| county_fips | string | No | County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data. |
| state_fips | string | Yes | US state FIPS code (e.g. 06 for California, 36 for New York, * for all states) |
| year | integer | No | Survey year (default 2022). ACS 5-year estimates available 2010-2022. |
POST /api/v1/tools/spending.awards/call dynamic
Search 60M+ US federal contract and grant awards by keyword, recipient, or NAICS code. Returns award amount, recipient, agency, dates, and description. Sorted by amount descending. Source: USAspending.gov (DATA Act mandate, US Gov open data).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| award_type | string | No |
Filter by award type: contracts, grants, or all (default: all)
enum: contracts, grants, all |
| fiscal_year | integer | No | Fiscal year to filter (e.g. 2025). Default: current year. |
| keyword | string | Yes | Search keyword for federal awards (e.g. "artificial intelligence", "cybersecurity", company name) |
| limit | integer | No | Number of results to return (1-25, default 10) |
POST /api/v1/tools/spending.agency/call dynamic
Search federal awards by agency name (e.g. "Defense", "NASA", "Health and Human Services"). Returns top awards by amount for a fiscal year. Source: USAspending.gov — covers all federal agencies.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| agency_name | string | Yes | Federal agency name or keyword (e.g. "Defense", "NASA", "Health and Human Services") |
| fiscal_year | integer | No | Fiscal year (e.g. 2025). Default: current year. |
| limit | integer | No | Number of top awards to return (1-25, default 10) |
POST /api/v1/tools/spending.geography/call dynamic
Get total US federal spending by state for contracts, grants, or all awards in a fiscal year. Returns all 50+ states sorted by spending amount. Useful for regional economic analysis and policy research. Source: USAspending.gov.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| award_type | string | No |
Filter by award type: contracts, grants, or all (default: all)
enum: contracts, grants, all |
| fiscal_year | integer | No | Fiscal year (e.g. 2025). Default: current year. |
POST /api/v1/tools/sam.entity_search/call dynamic
Search 700K+ registered US federal contractors and grantees by company name, state, or NAICS code. Returns UEI (Unique Entity Identifier), CAGE code, registration status, business types (Small Business, 8(a), HUBZone, WOSB, Veteran-Owned), and NAICS codes. Source: SAM.gov (GSA).
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-25, default 10) |
| naics_code | string | No | NAICS industry code to filter (e.g. 541512 for Computer Systems Design) |
| name | string | Yes | Company or organization name to search (e.g. "Lockheed", "Google", "Deloitte"). Supports partial match. |
| state | string | No | US state code to filter (e.g. VA, CA, TX) |
POST /api/v1/tools/sam.entity_detail/call dynamic
Get full SAM.gov registration details for a federal contractor by UEI (Unique Entity Identifier). Returns legal name, CAGE code, addresses, NAICS/PSC codes, business certifications, entity structure, organization type, and registration dates. Source: SAM.gov (GSA).
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| uei | string | Yes | Unique Entity Identifier (UEI) — 12-character SAM.gov ID (e.g. KM99JJBNQ9M5 for Lockheed Martin) |
POST /api/v1/tools/fema.disasters/call dynamic
Search US federal disaster declarations from 1953 to present. Filter by state, incident type (Fire, Flood, Hurricane, Tornado, Earthquake), and year. Returns disaster number, title, dates, designated programs (IA, PA, HM). Source: OpenFEMA (US Gov open data).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| incident_type | string | No |
Disaster type to filter (e.g. Fire, Flood, Hurricane)
enum: Fire, Flood, Hurricane, Tornado, Earthquake, Severe Storm(s), Snow, Drought, Typhoon, Biological, Other |
| limit | integer | No | Number of results (1-50, default 10) |
| state | string | No | US state code (e.g. CA, TX, FL). Omit for all states. |
| year | integer | No | Filter by declaration year (1953-2026) |
POST /api/v1/tools/fema.flood_claims/call dynamic
Retrieve National Flood Insurance Program (NFIP) claims by state and year. Returns flood zone, building/contents payments, insurance coverage amounts, cause of damage. Essential for flood risk assessment and insurance analysis. Source: OpenFEMA.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-50, default 10) |
| state | string | Yes | US state code (e.g. FL, TX, LA) |
| year | integer | No | Year of loss to filter (e.g. 2024) |
POST /api/v1/tools/fema.assistance/call dynamic
Query federal disaster housing assistance data by state and disaster number. Returns registration counts, average damage, total inspected, approved amounts by county. Useful for disaster recovery analysis and aid distribution research. Source: OpenFEMA.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| disaster_number | integer | No | FEMA disaster number to filter (e.g. 4673) |
| limit | integer | No | Number of results (1-50, default 10) |
| state | string | Yes | US state code (e.g. TX, FL, CA) |
POST /api/v1/tools/pypi.package_info/call dynamic
Get metadata for any Python package from PyPI: version, summary, license, author, dependencies, classifiers, Python version requirements. 550K+ packages. Supports specific version lookup. Complements npm (UC-344) for polyglot dependency intelligence.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | Python package name (e.g. requests, flask, numpy, anthropic) |
| version | string | No | Specific version (e.g. 2.31.0). Defaults to latest release. |
POST /api/v1/tools/pypi.releases/call dynamic
List all published versions of a Python package with upload dates, yanked status, and distribution file types (sdist/wheel). Returns the 50 most recent versions. Useful for dependency auditing, version pinning, and upgrade planning.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | Python package name to list all versions (e.g. django, pandas, scipy) |
POST /api/v1/tools/gbif.species_search/call dynamic
Search 9M+ species in the GBIF backbone taxonomy by common or scientific name. Returns taxon key, scientific name, kingdom/phylum/class/order/family/genus, and taxonomic status. Filter by rank (SPECIES, GENUS, FAMILY). Source: Global Biodiversity Information Facility (CC0).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-20, default 5) |
| query | string | Yes | Species name to search — common name (e.g. "polar bear") or scientific name (e.g. "Ursus maritimus") |
| rank | string | No |
Taxonomic rank filter (default: SPECIES). Use SPECIES to avoid virus/subspecies matches.
enum: KINGDOM, PHYLUM, CLASS, ORDER, FAMILY, GENUS, SPECIES |
POST /api/v1/tools/gbif.species_details/call dynamic
Get full taxonomic profile for a species by GBIF taxon key. Returns classification hierarchy, vernacular (common) names, synonyms, number of descendants, and accepted name. Source: GBIF backbone taxonomy.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| taxon_key | integer | Yes | GBIF taxon key (numeric ID from species search results) |
POST /api/v1/tools/gbif.occurrences/call dynamic
Search 2.5B+ species occurrence records by taxon, country, and year. Returns observation coordinates, date, collector institution, basis of record (specimen/observation). Filter by ISO country code. Source: GBIF (2000+ institutions, 100+ countries).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO 3166-1 alpha-2 country code (e.g. US, GB, BR, AU) |
| limit | integer | No | Number of results (1-50, default 10) |
| taxon_key | integer | Yes | GBIF taxon key for the species to search occurrences |
| year | integer | No | Filter by observation year (e.g. 2024) |
POST /api/v1/tools/gbif.occurrence_count/call dynamic
Get total occurrence count for a species, optionally filtered by country. Useful for range size estimation, data density assessment, and conservation status analysis. Source: GBIF.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| country | string | No | ISO country code to filter count (e.g. US, BR) |
| taxon_key | integer | Yes | GBIF taxon key to count occurrences for |
POST /api/v1/tools/congress.bills/call dynamic
Search US federal bills and resolutions from 1973 to present. Filter by Congress number (93-119), bill type (hr/s/hjres/sjres). Returns title, sponsor, party, latest action, policy area. Source: Congress.gov (Library of Congress).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| congress | integer | No | Congress number (93=1973 to 119=2025-2026). Default: current (119). |
| limit | integer | No | Number of results (1-25, default 10) |
| type | string | No |
Bill type: hr (House), s (Senate), hjres, sjres, hconres, sconres, hres, sres
enum: hr, s, hjres, sjres, hconres, sconres, hres, sres |
POST /api/v1/tools/congress.bill_details/call dynamic
Get full details for a specific US bill by Congress number, type (hr/s), and bill number. Returns title, all sponsors, co-sponsor count, action history, committee referrals, policy subjects. Source: Congress.gov.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| congress | integer | Yes | Congress number (e.g. 119 for 2025-2026, 118 for 2023-2024) |
| number | integer | Yes | Bill number (e.g. 1 for HR 1) |
| type | string | Yes |
Bill type: hr (House bill), s (Senate bill), hjres, sjres, etc.
enum: hr, s, hjres, sjres, hconres, sconres, hres, sres |
POST /api/v1/tools/congress.members/call dynamic
Search current and historical members of the US Congress. Filter by state, chamber (House/Senate), and Congress number. Returns name, party, state, district, bioguide ID. Source: Congress.gov.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| chamber | string | No |
Chamber: house or senate
enum: house, senate |
| congress | integer | No | Congress number. Default: current (119). |
| limit | integer | No | Number of results (1-25, default 10) |
| state | string | No | US state code (e.g. CA, TX, NY) |
POST /api/v1/tools/depsdev.package/call dynamic
Get package metadata from Google deps.dev — all versions, default version, ecosystem. Covers npm, PyPI, Go, Maven, Cargo, NuGet (50M+ package versions). Complements npm/PyPI registries with cross-ecosystem unified view.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | Package name (e.g. express, requests, gin-gonic/gin, log4j-core) |
| system | string | Yes |
Package ecosystem: npm, pypi, go, maven, cargo, or nuget
enum: npm, pypi, go, maven, cargo, nuget |
POST /api/v1/tools/depsdev.dependencies/call dynamic
Resolve the full transitive dependency tree for a package version. Returns all direct and indirect dependencies with versions and relation type. Reveals hidden supply chain depth (e.g. [email protected] has 67 transitive deps). Google deps.dev.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | Package name (e.g. lodash, flask, github.com/gin-gonic/gin) |
| system | string | Yes |
Package ecosystem: npm, pypi, go, maven, cargo, or nuget
enum: npm, pypi, go, maven, cargo, nuget |
| version | string | Yes | Package version to resolve dependencies for (e.g. 4.17.21, 3.0.0) |
POST /api/v1/tools/depsdev.advisories/call dynamic
List security advisories (from OSV) affecting a specific package version. Cross-ecosystem: npm, PyPI, Go, Maven, Cargo, NuGet. Returns advisory IDs with links to OSV.dev for full details. Complements osv.query for version-specific lookups.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| package | string | Yes | Package name to check for security advisories |
| system | string | Yes |
Package ecosystem: npm, pypi, go, maven, cargo, or nuget
enum: npm, pypi, go, maven, cargo, nuget |
| version | string | Yes | Package version to check (e.g. 4.17.20) |
POST /api/v1/tools/epa.toxic_releases/call dynamic
Search EPA Toxic Release Inventory (TRI) facilities by US state or ZIP code. Returns facility name, address, county, industry sector, and closed status. 600K+ regulated facilities. Source: EPA Envirofacts (US Gov open data).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-50, default 10) |
| state | string | Yes | US state code (e.g. CA, TX, NY, FL) |
| zip_code | string | No | ZIP code to filter (e.g. 90001). Overrides state filter if provided. |
POST /api/v1/tools/epa.water_systems/call dynamic
Search public water systems by US state. Returns system name, PWSID, activity status, primacy agency, EPA region, population served, and service connections. Source: EPA Safe Drinking Water Act data.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-50, default 10) |
| state | string | Yes | US state code (e.g. FL, CA, TX) |
POST /api/v1/tools/ncei.stations/call dynamic
Search 100K+ global weather stations from NOAA NCEI by location (state FIPS, ZIP, country). Returns station ID, name, coordinates, elevation, and data coverage dates (some from 1700s). Use station IDs with ncei.daily_data for historical climate records.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of stations to return (1-25, default 10) |
| location_id | string | Yes | Location ID: FIPS:06 (California), FIPS:36 (New York), ZIP:10001, CITY:US360019, or CNTRY:US |
POST /api/v1/tools/ncei.daily_data/call dynamic
Retrieve historical daily weather observations from NOAA NCEI — max/min temperature, precipitation, snowfall, wind speed. 260+ years of records from global stations. Values in tenths of °C (temp) and tenths of mm (precip). Source: GHCND dataset.
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| datatypes | string | No | Comma-separated data types: TMAX (max temp), TMIN (min temp), PRCP (precipitation), SNOW, AWND (avg wind). Default: all. |
| end_date | string | Yes | End date in YYYY-MM-DD format (e.g. 2025-01-31). Max 1 year range. |
| start_date | string | Yes | Start date in YYYY-MM-DD format (e.g. 2025-01-01) |
| station_id | string | Yes | NCEI station ID (e.g. GHCND:USW00094728 for Central Park, NY). Get from ncei.stations tool. |
POST /api/v1/tools/climate.temperature/call dynamic
Global surface temperature anomaly from NASA GISS — monthly readings since 1880. Values in °C vs 1951-1980 baseline. Returns last 10 years by default (adjustable 1-50). Source: NASA Goddard Institute for Space Studies.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| years | integer | No | Number of years of data to return (1-50, default 10). Data is monthly. |
POST /api/v1/tools/climate.co2/call dynamic
Atmospheric CO2 concentration from NOAA Mauna Loa Observatory — the Keeling Curve. Monthly readings in ppm (parts per million) since 1958. Returns last 10 years by default. Source: NOAA ESRL.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| years | integer | No | Number of years of data to return (1-50, default 10). Data is monthly. |
POST /api/v1/tools/climate.methane/call dynamic
Atmospheric methane concentration from NOAA ESRL — monthly readings in ppb (parts per billion) since 1983. Methane is the second most important greenhouse gas after CO2. Returns last 10 years by default.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| years | integer | No | Number of years of data to return (1-50, default 10). Data is monthly. |
POST /api/v1/tools/climate.nitrous_oxide/call dynamic
Atmospheric nitrous oxide concentration from NOAA ESRL — monthly readings in ppb since 2001. N2O is a potent greenhouse gas with 273x the warming potential of CO2. Returns last 10 years by default.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| years | integer | No | Number of years of data to return (1-50, default 10). Data is monthly. |
POST /api/v1/tools/climate.arctic_ice/call dynamic
Arctic sea ice extent from NSIDC — monthly measurements in million km² since 1979. Tracks long-term decline in Arctic ice coverage. Returns last 10 years by default. Source: National Snow and Ice Data Center.
- Amount
- 0.003000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.003000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| years | integer | No | Number of years of data to return (1-50, default 10). Data is monthly. |
POST /api/v1/tools/chart.create/call dynamic
⚡ ACTION: Generate a chart image (PNG) from data — bar, line, pie, doughnut, radar, scatter. Returns a permanent image URL. Combine with data tools (climate.co2, census.population, finance.exchange_rates) to visualize any dataset. Powered by QuickChart (Chart.js).
- Amount
- 0.002000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.002000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| datasets | array | Yes | One or more datasets to plot |
| height | integer | No | Image height in pixels (100-1000, default 300) |
| labels | array | Yes | X-axis labels (e.g. ["Q1", "Q2", "Q3", "Q4"]) |
| title | string | No | Chart title displayed at top |
| type | string | Yes |
Chart type: bar, line, pie, doughnut, radar, scatter, horizontalBar
enum: bar, line, pie, doughnut, radar, scatter, horizontalBar |
| width | integer | No | Image width in pixels (100-1000, default 500) |
POST /api/v1/tools/figi.map/call dynamic
Resolve financial instrument identifiers — ISIN, CUSIP, SEDOL, or ticker symbol to Bloomberg FIGI (ISO 18774). Returns FIGI, composite FIGI, security name, type, and exchange. 300M+ instruments across 45K+ exchanges. Use ID_ISIN, ID_CUSIP, ID_SEDOL, or TICKER as id_type.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| exchange_code | string | No | Exchange code to narrow results (e.g. US, LN, JP). Optional. |
| id_type | string | Yes |
Identifier type: ID_ISIN, ID_CUSIP, ID_SEDOL, TICKER, ID_BB_GLOBAL
enum: ID_ISIN, ID_CUSIP, ID_SEDOL, ID_BB_GLOBAL, TICKER, ID_WERTPAPIER, ID_COMMON |
| id_value | string | Yes | Identifier value (e.g. US0378331005 for ISIN, AAPL for ticker, BBG000B9XRY4 for FIGI) |
POST /api/v1/tools/figi.search/call dynamic
Search 300M+ financial instruments by company name or ticker keyword. Filter by exchange and security type. Returns Bloomberg FIGI, ticker, name, market sector. Covers equities, ETPs, bonds, derivatives globally.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| exchange_code | string | No | Filter by exchange code (e.g. US, LN, JP) |
| query | string | Yes | Search query — company name or ticker (e.g. "Tesla", "Apple Inc", "MSFT") |
| security_type | string | No | Filter by security type (e.g. "Common Stock", "ETP", "REIT") |
POST /api/v1/tools/figi.filter/call dynamic
Filter financial instruments by exchange code, market sector (Equity/Corp/Govt/Index/Curncy/Comdty), or security type (Common Stock/ETP/REIT/ADR). Browse instrument universe by structured criteria. Bloomberg OpenFIGI.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| exchange_code | string | No | Exchange code (e.g. US, LN, HK, JP) |
| market_sector | string | No | Market sector (e.g. Equity, Corp, Govt, Index, Curncy, Comdty) |
| security_type | string | No | Security type (e.g. "Common Stock", "ETP", "REIT", "ADR") |
POST /api/v1/tools/usno.moon_phases/call dynamic
Get all moon phase dates for a year — New Moon, First Quarter, Full Moon, Last Quarter with exact UTC timestamps. ~50 phases per year. Source: US Naval Observatory (canonical astronomical authority, US Gov public domain).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| year | integer | No | Year for moon phases (default: current year, e.g. 2026) |
POST /api/v1/tools/usno.sun_moon/call dynamic
Get sunrise, sunset, moonrise, moonset, and transit times for any location and date. Includes civil/nautical/astronomical twilight. Used for photography golden hour, agriculture planning, outdoor events. Source: USNO.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| date | string | Yes | Date in YYYY-MM-DD format (e.g. 2026-04-07) |
| latitude | number | Yes | Latitude in decimal degrees (e.g. 40.7128 for New York) |
| longitude | number | Yes | Longitude in decimal degrees (e.g. -74.0060 for New York) |
POST /api/v1/tools/usno.seasons/call dynamic
Get exact dates and UTC times for vernal equinox, summer solstice, autumnal equinox, and winter solstice for any year. Also includes Earth perihelion and aphelion dates. Source: US Naval Observatory.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| year | integer | No | Year for equinoxes and solstices (default: current year) |
POST /api/v1/tools/wger.exercise_search/call dynamic
Search 896 exercises by name — bench press, squat, deadlift, curl, etc. Returns exercise name, category (Chest/Back/Legs/Arms/Abs/Shoulders/Cardio), and ID for details lookup. Open-source fitness database (Wger, CC-BY-SA).
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| term | string | Yes | Exercise name to search (e.g. "bench press", "squat", "deadlift", "bicep curl") |
POST /api/v1/tools/wger.exercise_details/call dynamic
Get full exercise details by ID — description, primary and secondary muscles worked, required equipment (barbell/dumbbell/bodyweight/machine), and category. Use with exercise_search to build workout plans.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| id | integer | Yes | Exercise base ID from search results (e.g. 615 for Squats) |
POST /api/v1/tools/wger.ingredients/call dynamic
Search 1.28M food ingredients by name — chicken breast, rice, banana, oats. Returns calories (kcal), protein, carbs, fat, fiber, sugar, sodium per 100g. Complements USDA FDC with broader international coverage.
- Amount
- 0.001000
- Currency
- -
- Method
- x402, mpp
- Intent
- -
- 402 Declared
- Yes
price: 0.001000 pricingMode: fixed protocols: [x402 mpp]
Parameters
| Name | In | Type | Required | Description |
|---|---|---|---|---|
| toolId | path | string | Yes | - |
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
| limit | integer | No | Number of results (1-20, default 10) |
| name | string | Yes | Food ingredient name (e.g. "chicken breast", "rice", "banana", "oats") |
Payment Methods
- Methods
- -
- Intents
- -
- Currencies (discovery)
- -
- Multiple Challenges
- No
Security
- TLS Version
- TLSv1.3
- Challenge ID Unique
- -
- Challenge ID Length
- -
- Digest Binding
- -
Uptime
- Discovery
- Reachable (1204ms)
- Challenge
- Reachable (579ms)
- Last Checked
Schema Completeness
- Paid Operations
- 484
- With Input Schema
- 484
- With Description
- 484
Documentation
- Homepage
- -
- API Reference
- -
- llms.txt
- -
Discovery
- OpenAPI URL
- https://apibase.pro/openapi.json
- OpenAPI Version
- 3.1.0
- Service Version
- 1.0.0
- Document Size
- 1.291998e+06 bytes
- Document Hash
- 5317202a02bab8183aa4b6d29552b0c7ac1fbe08c56534416aaf8018eb8be856
Version History (2 snapshots)
- new endpoint: POST /api/v1/tools/wger.exercise_details/call
- new endpoint: POST /api/v1/tools/wger.exercise_search/call
- new endpoint: POST /api/v1/tools/wger.ingredients/call
- new endpoint: POST /api/v1/tools/usno.moon_phases/call
- new endpoint: POST /api/v1/tools/usno.seasons/call
- new endpoint: POST /api/v1/tools/usno.sun_moon/call
- new endpoint: POST /api/v1/tools/edgar.xbrl_concept/call
- new endpoint: POST /api/v1/tools/edgar.xbrl_frames/call
- new endpoint: POST /api/v1/tools/figi.filter/call
- new endpoint: POST /api/v1/tools/figi.map/call
- new endpoint: POST /api/v1/tools/figi.search/call
Scan snapshots
| Date | Grade | Score | Response | Status |
|---|---|---|---|---|
| 2026-04-06 | D | 58% | 1209ms | Up |
| 2026-04-07 | D | 58% | 1370ms | Up |